DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and CG13510

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001246465.1 Gene:CG13510 / 37596 FlyBaseID:FBgn0034758 Length:129 Species:Drosophila melanogaster


Alignment Length:131 Identity:46/131 - (35%)
Similarity:66/131 - (50%) Gaps:19/131 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 PPSYDVAVSVPVAPAVSAPAIAPARPPPVVVVEQPAPQPP--------TVVPTDTLHLGPNRSRV 97
            ||.|  :......||.:.....|.:||    :..|.||||        |...::.:.:|...:|:
  Fly     6 PPPY--SEQSGYTPAQTYQPGGPTQPP----LYPPMPQPPQSSTVIIQTTTTSNLVPIGSGPTRI 64

  Fly    98 LCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCC--CACFVPYCMNSCRTGNHYCRKCNTFLGA 160
            .||:|.|...|.:..|.:.|||..|.:|||  |.|  |.| :||||:||:..||||..|:.::|.
  Fly    65 RCPSCHAEVLTTVKSTPSGRTHCWALILCL--FICWPCVC-LPYCMDSCQNANHYCPNCSAYIGT 126

  Fly   161 Y 161
            |
  Fly   127 Y 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 31/68 (46%)
CG13510NP_001246465.1 zf-LITAF-like 61..128 CDD:287559 31/70 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448953
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2DZV6
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D136484at33392
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.