DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and Cdip1

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001008361.1 Gene:Cdip1 / 360480 RGDID:1310686 Length:208 Species:Rattus norvegicus


Alignment Length:214 Identity:49/214 - (22%)
Similarity:70/214 - (32%) Gaps:79/214 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YPQVDFNAPTAP-------------------------SPTPTRELGNPIANGLPIEAPPSYDVAV 48
            ||    ..||||                         .|.|:.::..|     |.| ||.:.|..
  Rat     9 YP----GGPTAPLLEEKSGAPHTPGRTSPAVMQPPPGMPLPSADIAPP-----PYE-PPGHPVPQ 63

  Fly    49 SVPVAPAVSA-----PA--IAPARPPPVVVVEQPAPQPPTVVPTDTLH----LGPNRS------- 95
            ...|.|.::|     ||  ..|..|.|.:....|.|.||...|....|    |.|:.:       
  Rat    64 PGFVPPHMNADGTYMPAGFYPPPGPHPPMGYYPPGPYPPGSYPGPGGHTATVLVPSGAATTVTVL 128

  Fly    96 ----------RVLCPACGANKTTRMTHTANSRTHMVAGLLCLV-GFCCC-------ACFVPYCMN 142
                      :.:||.|....||::::.        .||:..| ||.||       .|.:|..:|
  Rat   129 QGEIFEGAPVQTVCPHCQQAITTKISYE--------IGLMNFVLGFFCCFMGCDLGCCLIPCLIN 185

  Fly   143 SCRTGNHYCRKCNTFLGAY 161
            ..:...|.|..|..::..|
  Rat   186 DFKDVTHTCPSCKAYICTY 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 19/74 (26%)
Cdip1NP_001008361.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70 15/70 (21%)
zf-LITAF-like 137..205 CDD:402300 19/76 (25%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 164..184 6/19 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339285
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.