DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and Y87G2A.18

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001021834.1 Gene:Y87G2A.18 / 3564964 WormBaseID:WBGene00013604 Length:118 Species:Caenorhabditis elegans


Alignment Length:112 Identity:28/112 - (25%)
Similarity:41/112 - (36%) Gaps:32/112 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 VEQPAPQPPTVVPTDTLHLGP-NRSRVL---------------CPACGANKTTRMTHTANSRTHM 120
            |||.||:|           .| |.||.:               ||.|..:..:.:...|.....:
 Worm    16 VEQNAPEP-----------NPQNDSRYITSRTSPYNVMPIEMDCPHCQNHIVSHIERVAGVLPWI 69

  Fly   121 VAGLLCLVGFCC-----CACFVPYCMNSCRTGNHYCRKCNTFLGAYN 162
            :..:|..:|...     |.|.||:.::.....||.|..|..|||.:|
 Worm    70 IFAILAFLGIFLFIIPWCFCCVPFFLDQLLDVNHSCPACKKFLGRFN 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 18/85 (21%)
Y87G2A.18NP_001021834.1 LITAF 43..117 CDD:197841 18/74 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.070

Return to query results.
Submit another query.