DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and CG30273

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_726223.1 Gene:CG30273 / 246520 FlyBaseID:FBgn0050273 Length:128 Species:Drosophila melanogaster


Alignment Length:163 Identity:56/163 - (34%)
Similarity:75/163 - (46%) Gaps:44/163 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 MLYPQVDFNAPTAPSPTPTRELGNPIANGLPIEAPPSYDVAVSVPVAPAVSAPAIAPAR------ 65
            |.|.|....||..|...|                ||||:..|.|.          ||.|      
  Fly     1 MQYNQQPAGAPGYPHQMP----------------PPSYEQVVHVQ----------APVRVVHHTT 39

  Fly    66 -PPPVVVVEQPAPQPPTVVPTDTLHLGPNRSRVLCPACGANKTTRMTHTANSRTHMVAGLLCLVG 129
             |||||:::..|..|          :||:.:.:.||.|...|.||:.::.:.:||.:|.:||:||
  Fly    40 APPPVVIIQHQAVLP----------VGPDPTFITCPHCHVQKLTRVEYSPSVKTHCMAAILCIVG 94

  Fly   130 FCCCACFVPYCMNSCRTGNHYCRKCNTFLGAYN 162
            ..|||| :|||..||...||:|..||.|:|.||
  Fly    95 LWCCAC-LPYCATSCMNANHFCGNCNKFVGVYN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 29/65 (45%)
CG30273NP_726223.1 zf-LITAF-like 59..126 CDD:287559 29/67 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448959
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 53 1.000 Inparanoid score I4084
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.990

Return to query results.
Submit another query.