DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and Y40H7A.11

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_502837.1 Gene:Y40H7A.11 / 189810 WormBaseID:WBGene00012748 Length:124 Species:Caenorhabditis elegans


Alignment Length:122 Identity:33/122 - (27%)
Similarity:45/122 - (36%) Gaps:17/122 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 APPSYDVAVSVPVAPAVSAPAIAP---ARPPPVVVVEQPAPQPPTVVPTDTLHLGPNRSRVLCPA 101
            |||.|:||:.:|......||.:||   .||...|:......|.||.          :..:..|..
 Worm    11 APPPYEVAIGMPKVNRQPAPVLAPPIDPRPCGRVIGVISVKQAPTY----------SSYQENCTR 65

  Fly   102 CGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFVPYCMNSCRTGNHYCRKCNTFL 158
            |.....||:.|.......:.|.|.....|||...|.|.    .:...|:|..|.:.|
 Worm    66 CQTLVQTRVEHKIGIMWWLCATLSFCFFFCCYLLFFPI----TKDAQHFCPNCGSLL 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 16/63 (25%)
Y40H7A.11NP_502837.1 LITAF 58..123 CDD:197841 16/65 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158632
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.910

Return to query results.
Submit another query.