DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and F16F9.1

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_509434.2 Gene:F16F9.1 / 184573 WormBaseID:WBGene00017513 Length:157 Species:Caenorhabditis elegans


Alignment Length:158 Identity:49/158 - (31%)
Similarity:63/158 - (39%) Gaps:41/158 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LPIEAPPSYDVAVSVPVAP-------------------------AVSAPAIAPARPPPVVVVEQ- 74
            :|...||||.     |..|                         .||.|...|...|.|:.||| 
 Worm     1 MPESPPPSYS-----PRRPPPPYEEQNNRNAKKESTMGTPEHHYKVSPPPFVPLTQPTVIDVEQL 60

  Fly    75 -----PAPQP-PTVVPTDTLHLGPNRS--RVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFC 131
                 |..|| ||||...|....|:.:  ...|.:||....|.......|.|.:|. :|.|:.|.
 Worm    61 QNVVLPGGQPNPTVVIVTTPKPAPSFASYETTCYSCGKYVHTLPKFVIGSLTWIVF-ILVLICFF 124

  Fly   132 CCACFVPYCMNSCRTGNHYCRKCNTFLG 159
            ..| |||:|::||:..:|||.:||..||
 Worm   125 PLA-FVPFCLDSCKDAHHYCPRCNALLG 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 24/64 (38%)
F16F9.1NP_509434.2 zf-LITAF-like 88..154 CDD:371158 24/66 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158610
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54946
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - otm14624
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.920

Return to query results.
Submit another query.