DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and LITAFD

DIOPT Version :10

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:NP_001382362.1 Gene:LITAFD / 101929989 HGNCID:53927 Length:72 Species:Homo sapiens


Alignment Length:67 Identity:19/67 - (28%)
Similarity:29/67 - (43%) Gaps:0/67 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFVPYCMNSCRTGNHYCRKCNTFLGA 160
            :.:||.||....|..|....:.|.::...|.|.|:....||:.:|:.|.....|.|..|...|..
Human     4 QAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFY 68

  Fly   161 YN 162
            |:
Human    69 YH 70

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 92..162 CDD:463165 18/65 (28%)
LITAFDNP_001382362.1 zf-LITAF-like 2..70 CDD:463165 18/65 (28%)
Membrane-binding amphipathic helix. /evidence=ECO:0000250|UniProtKB:Q99732 22..45 5/22 (23%)

Return to query results.
Submit another query.