powered by:
Protein Alignment CG13516 and LITAFD
DIOPT Version :9
Sequence 1: | NP_001033966.1 |
Gene: | CG13516 / 3885599 |
FlyBaseID: | FBgn0040658 |
Length: | 168 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_011521084.1 |
Gene: | LITAFD / 101929989 |
HGNCID: | 53927 |
Length: | 121 |
Species: | Homo sapiens |
Alignment Length: | 67 |
Identity: | 19/67 - (28%) |
Similarity: | 29/67 - (43%) |
Gaps: | 0/67 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 96 RVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFVPYCMNSCRTGNHYCRKCNTFLGA 160
:.:||.||....|..|....:.|.::...|.|.|:....||:.:|:.|.....|.|..|...|..
Human 53 QAVCPYCGNRIITVTTFVPGALTWLLCTTLFLFGYVLGCCFLAFCIRSLMDVKHSCPVCQRELFY 117
Fly 161 YN 162
|:
Human 118 YH 119
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1564782at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000358 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
O |
PTHR23292 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
4 | 4.020 |
|
Return to query results.
Submit another query.