DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13516 and litafd

DIOPT Version :9

Sequence 1:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster
Sequence 2:XP_002939491.1 Gene:litafd / 100498168 XenbaseID:XB-GENE-22164436 Length:141 Species:Xenopus tropicalis


Alignment Length:139 Identity:46/139 - (33%)
Similarity:66/139 - (47%) Gaps:13/139 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GNP-IANGLPIEAPPSYDVAVSVPVAPAVSAPAIAPARPPPVV--VVEQPAPQPPTVVP---TDT 87
            ||| ::.|.|   .|.:..|...|.|...|:.|:.|  ||||.  :..||...||.|.|   |.|
 Frog     7 GNPAMSAGYP---QPGFGGAYPPPPAYNPSSGAVYP--PPPVYNSIPGQPVTVPPVVTPIIVTST 66

  Fly    88 LHLGPNRSRVLCPACGANKTTRMTHTANSRTHMVAGLLCLVGFCCCACFVPYCMNSCRTGNHYCR 152
            ....|  :...||:|..|..|.:.:.....|.::.|:|.:.|.....|.:|:|::||:..:|||.
 Frog    67 FQDTP--ASTTCPSCRQNIITNIHYNIGLLTWLLFGILFIFGCWLGCCLIPFCVDSCKDVDHYCP 129

  Fly   153 KCNTFLGAY 161
            .||..|..|
 Frog   130 NCNHHLYKY 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13516NP_001033966.1 zf-LITAF-like 96..162 CDD:287559 21/66 (32%)
litafdXP_002939491.1 zf-LITAF-like 70..139 CDD:371158 22/71 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.