DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and CD86

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_787058.5 Gene:CD86 / 942 HGNCID:1705 Length:329 Species:Homo sapiens


Alignment Length:217 Identity:60/217 - (27%)
Similarity:93/217 - (42%) Gaps:54/217 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   192 TAHVPCTV-----HHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKH-------SEDWTL 244
            ||.:||..     ..:.|.||.|..:::..|..|    |...|:|.:.|.|:       |:.|||
Human    35 TADLPCQFANSQNQSLSELVVFWQDQENLVLNEV----YLGKEKFDSVHSKYMGRTSFDSDSWTL 95

  Fly   245 QIKFVQLRDAGVYECQVSTHPPTS-IFLH-----LSVVEARAEITGP---PIRYLTPGSTLRLQC 300
            ::..:|::|.|:|:|.:....||. |.:|     |||:   |..:.|   ||..:|....:.|.|
Human    96 RLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVL
---ANFSQPEIVPISNITENVYINLTC 157

  Fly   301 ------------RVVQNTEAS--EY---IFWYHDNRMINYDIDRGINVSTEPDFQSSELTI---- 344
                        .|:..|:.|  ||   :....||....||:...::||. ||. :|.:||    
Human   158 SSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSF-PDV-TSNMTIFCIL 220

  Fly   345 --QRTRREHSGNFTCVASNTQP 364
              .:||. .|..|:....:.||
Human   221 ETDKTRL-LSSPFSIELEDPQP 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 30/101 (30%)
IG_like 182..262 CDD:214653 24/81 (30%)
IG_like 285..362 CDD:214653 26/102 (25%)
IGc2 292..361 CDD:197706 22/91 (24%)
CD86NP_787058.5 IgV_CD86 28..133 CDD:319336 30/101 (30%)
Ig 136..221 CDD:325142 22/86 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 40 1.000 Domainoid score I12529
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1051626at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.