DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Igsf9

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001139272.1 Gene:Igsf9 / 93842 MGIID:2135283 Length:1179 Species:Mus musculus


Alignment Length:201 Identity:49/201 - (24%)
Similarity:83/201 - (41%) Gaps:39/201 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VTTQIGATAHVPCTV----HHIGEGVVSWIRKKDYHLLTV----GLTTYSSDERFSATHLKHSED 241
            |..:.|.:|.:.|.:    .|....|:.|:|..  .||.:    ||.:...|..: ...::....
Mouse    29 VVGRAGESAVLGCDLLPPAGHPPLHVIEWLRFG--FLLPIFIQFGLYSPRIDPDY-VGRVRLQTG 90

  Fly   242 WTLQIKFVQLRDAGVYECQV---STHPPTSIF-----LHLSVVEARAEITGPPIRYLTPGSTLRL 298
            .:|||:.:::.|.|.|||:|   ..|.|...|     :||:|       ..||....||...|.:
Mouse    91 ASLQIEGLRVEDQGWYECRV
LFLDQHSPEQDFANGSWVHLTV-------NSPPQFQETPPLVLEV 148

  Fly   299 Q------CRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTC 357
            :      .|.|.......|:.|    :....|:.:|   ..:...|:..|.|:|..|..:|::||
Mouse   149 KELEAVTLRCVARGSPQPYVTW----KFRGQDLGKG---QGQVQVQNGTLWIRRVERGSAGDYTC 206

  Fly   358 VASNTQ 363
            .||:::
Mouse   207 QASSSE 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 27/106 (25%)
IG_like 182..262 CDD:214653 22/87 (25%)
IG_like 285..362 CDD:214653 21/82 (26%)
IGc2 292..361 CDD:197706 17/74 (23%)
Igsf9NP_001139272.1 IG_like 28..110 CDD:214653 21/83 (25%)
Ig 136..223 CDD:386229 20/84 (24%)
Ig_3 227..305 CDD:372822
Ig 341..404 CDD:386229
Ig 436..500 CDD:319273
FN3 508..599 CDD:238020
FN3 625..715 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 767..807
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 819..842
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 942..974
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1016..1079
PDZ-binding 1177..1179
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.