DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and PAPLN

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001352835.1 Gene:PAPLN / 89932 HGNCID:19262 Length:1278 Species:Homo sapiens


Alignment Length:418 Identity:91/418 - (21%)
Similarity:130/418 - (31%) Gaps:129/418 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 SSGLYRIKNGRVLDRLQKPAALIFIIAYIAACGICDHT------------ASASPG-GGKTVAAT 55
            |.||:|        :.|:|..           |...||            .|.:|| ||.  |.:
Human   854 SGGLWR--------QDQQPGP-----------GEAPHTQAFGEWPWGQELGSRAPGLGGD--AGS 897

  Fly    56 MTTPASEPSVR----HINQNLIMSQSKEGEPVPV-----PQPYAQSAASAGGSSITS------FD 105
            ...|....|.|    .:..:|:  |:..|:.|.:     ..|.:|:|....|..|:|      ||
Human   898 PAPPFHSSSYRISLAGVEPSLV--QAALGQLVRLSCSDDTAPESQAAWQKDGQPISSDRHRLQFD 960

  Fly   106 STNVIDG-QSQPTPTH-------------------------LQEAVLQTHSHSRIQAKD-----T 139
            .:.:|.. |::...|:                         |.||.|......|..|:|     .
Human   961 GSLIIHPLQAEDAGTYSCGSTRPGRDSQKIQLRIIGGDMAVLSEAELSRFPQPRDPAQDFGQAGA 1025

  Fly   140 AGPY-PIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIG 203
            |||. .||...|:|. |.|..:.                  ....||....|....:.|......
Human  1026 AGPLGAIPSSHPQPA-NRLRLDQ------------------NQPRVVDASPGQRIRMTCRAEGFP 1071

  Fly   204 EGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYEC-QVSTHPPT 267
            ...:.|.|               ..:..|:...:...|.:|.|..|.:.|.|.|.| ..:.....
Human  1072 PPAIEWQR---------------DGQPVSSPRHQLQPDGSLVISRVAVEDGGFYTCVAFNGQDRD 1121

  Fly   268 SIFLHLSVVEARAEITG-PPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINV 331
            ..::.|.|: ....|:| ||...:..|.|.||.|.|...   |..|.|..:...:..|   |..|
Human  1122 QRWVQLRVL-GELTISGLPPTVTVPEGDTARLLCVVAGE---SVNIRWSRNGLPVQAD---GHRV 1179

  Fly   332 STEPDFQSSELTIQRTRREHSGNFTCVA 359
            ...||   ..|.|...|....|::||.|
Human  1180 HQSPD---GTLLIYNLRARDEGSYTCSA 1204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 16/96 (17%)
IG_like 182..262 CDD:214653 15/80 (19%)
IG_like 285..362 CDD:214653 23/75 (31%)
IGc2 292..361 CDD:197706 21/68 (31%)
PAPLNNP_001352835.1 TSP1 29..80 CDD:214559
ADAM_spacer1 183..298 CDD:310520
TSP1 308..361 CDD:214559
TSP1 369..424 CDD:214559
TSP1 424..481 CDD:214559
TSP1 488..539 CDD:214559
Kunitz_BPTI 753..805 CDD:278443
Papilin_u7 814..905 CDD:318767 16/71 (23%)
Ig 914..>978 CDD:325142 15/65 (23%)
I-set 1049..1119 CDD:254352 15/84 (18%)
IG 1139..1219 CDD:214652 23/75 (31%)
PLAC 1235..1267 CDD:312271
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.