DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and dpr21

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001163838.2 Gene:dpr21 / 8674044 FlyBaseID:FBgn0260995 Length:282 Species:Drosophila melanogaster


Alignment Length:245 Identity:105/245 - (42%)
Similarity:145/245 - (59%) Gaps:7/245 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 PVHRPEPV---ENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVV 207
            |.|..|.|   :.:|.:.|.:.  |:.:.....||.|..:..||:.:|.|.|:.|.:.::|...|
  Fly    21 PQHFRENVTVTDLYLISENIVP--MKRVLDRGPYFDTSATKNVTSLVGITGHLNCRIKNLGNKTV 83

  Fly   208 SWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLH 272
            ||||.:|.|||||..:||:||:||::.:.|.:.||:|||||.||||:|:|||||||.||....:.
  Fly    84 SWIRHRDLHLLTVSESTYTSDQRFTSIYNKQTGDWSLQIKFPQLRDSGIYECQVSTTPPVGYTMV 148

  Fly   273 LSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDR-GINVSTEP- 335
            .||||....|.|.|..|:..|||:.|.|.:....:....:.|.|:|:.||||..| |::|.||. 
  Fly   149 FSVVEPITSILGGPEIYIDLGSTVNLTCVIKHLPDPPISVQWNHNNQEINYDSPRGGVSVITEKG 213

  Fly   336 DFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHV 385
            |..:|.|.|||.....||.:||:.||....||.|||.|||:|||:...|:
  Fly   214 DITTSYLLIQRASIADSGQYTCLPSNANSKSVNVHILKGDHPAAVQKSHL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 47/95 (49%)
IG_like 182..262 CDD:214653 41/79 (52%)
IG_like 285..362 CDD:214653 30/78 (38%)
IGc2 292..361 CDD:197706 27/70 (39%)
dpr21NP_001163838.2 Ig 71..149 CDD:299845 41/77 (53%)
IG_like 71..140 CDD:214653 38/68 (56%)
IG_like 162..249 CDD:214653 34/86 (40%)
IGc2 169..242 CDD:197706 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.