DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and KIRREL3

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_011541328.1 Gene:KIRREL3 / 84623 HGNCID:23204 Length:809 Species:Homo sapiens


Alignment Length:410 Identity:85/410 - (20%)
Similarity:150/410 - (36%) Gaps:131/410 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PASSGLYRIKNGRVLD------------RLQKPAALIFIIAYIAACG---ICDHTASASPGGGKT 51
            ||:|.:: ::.|.|::            :.:...:.:||.......|   :|..|..|.|||.:|
Human   183 PAASIIW-LRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKET 246

  Fly    52 VAATMTTPASEPSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQP 116
               ::|.....|.:  :|.::        ||.||.:           .::.:|..:    .::.|
Human   247 ---SVTIDIQHPPL--VNLSV--------EPQPVLE-----------DNVVTFHCS----AKANP 283

  Fly   117 TPTHLQEAVLQTHSHSRIQ-AKDTAGPYPIPVHR--------PEPVENHLEANNGIEGGMESLFG 172
                   ||.|.....|.| .|:.:|    .|:|        .|||.  .|..|.:  |..:|..
Human   284 -------AVTQYRWAKRGQIIKEASG----EVYRTTVDYTYFSEPVS--CEVTNAL--GSTNLSR 333

  Fly   173 T-PMYFGTENST---VVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSA 233
            | .:|||...:|   .:...:|:.|...|.........:.|:::        |.....|:|:   
Human   334 TVDVYFGPRMTTEPQSLLVDLGSDAIFSCAWTGNPSLTIVWMKR--------GSGVVLSNEK--- 387

  Fly   234 THLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVV--------EARAEITGPPI--- 287
                     ||.:|.|:..|||.|.|:             :||        |....:.||||   
Human   388 ---------TLTLKSVRQEDAGKYVCR-------------AVVPRVGAGEREVTLTVNGPPIISS 430

  Fly   288 ---RYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI------NYDIDRGINVSTEPDFQSSELT 343
               ::...|...:::| .:::|...:.|.|.....::      .|.::   .:|||....|: ||
Human   431 TQTQHALHGEKGQIKC-FIRSTPPPDRIAWSWKENVLESGTSGRYTVE---TISTEEGVIST-LT 490

  Fly   344 IQR-TRREHSGNFTCVASNT 362
            |.. .|.:....:.|.|.|:
Human   491 ISNIVRADFQTIYNCTAWNS 510

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 17/98 (17%)
IG_like 182..262 CDD:214653 17/82 (21%)
IG_like 285..362 CDD:214653 19/89 (21%)
IGc2 292..361 CDD:197706 16/75 (21%)
KIRREL3XP_011541328.1 Ig 58..149 CDD:299845
IG_like 60..149 CDD:214653
I-set 156..249 CDD:254352 15/69 (22%)
Ig2_KIRREL3-like 171..252 CDD:143236 16/72 (22%)
Ig_2 260..337 CDD:290606 23/114 (20%)
I-set 341..422 CDD:254352 20/113 (18%)
IGc2 355..406 CDD:197706 16/83 (19%)
Ig5_KIRREL3 424..521 CDD:143306 21/92 (23%)
IG_like 432..521 CDD:214653 17/84 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.