Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_954649.3 | Gene: | KIRREL2 / 84063 | HGNCID: | 18816 | Length: | 708 | Species: | Homo sapiens |
Alignment Length: | 232 | Identity: | 48/232 - (20%) |
---|---|---|---|
Similarity: | 78/232 - (33%) | Gaps: | 57/232 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 140 AGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGE 204
Fly 205 --GVVSWIRKKDYHLLTVGLTTYSSDERF----SATHLKHSEDWTLQIKFVQLRDAGVYECQVS- 262
Fly 263 ----THPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMIN- 322
Fly 323 YDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVA 359 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 25/106 (24%) |
IG_like | 182..262 | CDD:214653 | 22/85 (26%) | ||
IG_like | 285..362 | CDD:214653 | 15/76 (20%) | ||
IGc2 | 292..361 | CDD:197706 | 13/69 (19%) | ||
KIRREL2 | NP_954649.3 | IG_like | 30..119 | CDD:214653 | 26/133 (20%) |
IGc2 | 38..106 | CDD:197706 | 22/77 (29%) | ||
I-set | 126..224 | CDD:254352 | 16/81 (20%) | ||
Ig2_KIRREL3-like | 141..223 | CDD:143236 | 12/66 (18%) | ||
Cell attachment site. /evidence=ECO:0000255 | 149..151 | 0/1 (0%) | |||
Ig | 231..306 | CDD:299845 | |||
IG_like | 234..308 | CDD:214653 | |||
Ig | 312..395 | CDD:299845 | |||
I-set | 317..395 | CDD:254352 | |||
Ig | 397..501 | CDD:299845 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 545..601 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |