DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and KIRREL2

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_954649.3 Gene:KIRREL2 / 84063 HGNCID:18816 Length:708 Species:Homo sapiens


Alignment Length:232 Identity:48/232 - (20%)
Similarity:78/232 - (33%) Gaps:57/232 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 AGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGE 204
            |||.|..:.:||.                                :...:|..|.:||.   :|.
Human    20 AGPSPHFLQQPED--------------------------------LVVLLGEEARLPCA---LGA 49

  Fly   205 --GVVSWIRKKDYHLLTVGLTTYSSDERF----SATHLKHSEDWTLQIKFVQLRDAGVYECQVS- 262
              |:|.|.:.   .|...|........|:    :|.:.:|.    |.|:.|:|.|...||||.: 
Human    50 YWGLVQWTKS---GLALGGQRDLPGWSRYWISGNAANGQHD----LHIRPVELEDEASYECQATQ 107

  Fly   263 ----THPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMIN- 322
                :.|..   ||:.|.....::.|.|...|..|....|.||...:...:..:.|:.|..::: 
Human   108 AGLRSRPAQ---LHVLVPPEAPQVLGGPSVSLVAGVPANLTCRSRGDARPTPELLWFRDGVLLDG 169

  Fly   323 YDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVA 359
            ....:.:.....|....|.||:.....:....|.|.|
Human   170 ATFHQTLLKEGTPGSVESTLTLTPFSHDDGATFVCRA 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/106 (24%)
IG_like 182..262 CDD:214653 22/85 (26%)
IG_like 285..362 CDD:214653 15/76 (20%)
IGc2 292..361 CDD:197706 13/69 (19%)
KIRREL2NP_954649.3 IG_like 30..119 CDD:214653 26/133 (20%)
IGc2 38..106 CDD:197706 22/77 (29%)
I-set 126..224 CDD:254352 16/81 (20%)
Ig2_KIRREL3-like 141..223 CDD:143236 12/66 (18%)
Cell attachment site. /evidence=ECO:0000255 149..151 0/1 (0%)
Ig 231..306 CDD:299845
IG_like 234..308 CDD:214653
Ig 312..395 CDD:299845
I-set 317..395 CDD:254352
Ig 397..501 CDD:299845
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 545..601
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.