DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and CG34353

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001287571.1 Gene:CG34353 / 5740590 FlyBaseID:FBgn0085382 Length:581 Species:Drosophila melanogaster


Alignment Length:280 Identity:72/280 - (25%)
Similarity:111/280 - (39%) Gaps:65/280 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PMYFG-TENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLK 237
            ||:.. :|....:|   |.|..:||.|.:....||:|  |:...:||.|....:.|.|     ::
  Fly    86 PMFISRSETFKFIT---GETIVLPCEVANTDTYVVAW--KRGIAILTAGSVKVTPDPR-----VR 140

  Fly   238 HSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPP-IRYLT--------PG 293
            ....:.|||:.....|||.|.||::|..|..| .|      ..||..|| |.:::        .|
  Fly   141 LVNGFNLQIRDALPTDAGDYICQIATMDPREI-TH------TVEILVPPRIHHISTGGHLQVKKG 198

  Fly   294 STLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCV 358
            |::|::|....|...:  :.|...|.::         .:.|....|..|:|:...|...|.:.|.
  Fly   199 SSVRIECSATGNPMPN--VTWSRKNNIL---------PNGEEKLHSHVLSIENVDRHKGGVYICT 252

  Fly   359 ASNT--QPAS--VLVH-------------IFKGDNPAAMYHGHVGGSTK--------TTQSQLHM 398
            |:|.  ||||  |::|             :|.|:...|.....|.|.|:        |.|.....
  Fly   253 ANNRVGQPASSQVVLHVLFSPEISVERPVVFSGEGHEATLVCIVHGETQPEVIWFKDTMQLDTTE 317

  Fly   399 IMIIIASGYRIFHTSVYMKI 418
            ..|:...|.|  ||.:..|:
  Fly   318 RHIMETRGSR--HTLIIRKV 335

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 29/95 (31%)
IG_like 182..262 CDD:214653 24/79 (30%)
IG_like 285..362 CDD:214653 18/85 (21%)
IGc2 292..361 CDD:197706 15/68 (22%)
CG34353NP_001287571.1 IG_like 100..180 CDD:214653 29/93 (31%)
Ig 103..177 CDD:143165 25/87 (29%)
IG_like 191..269 CDD:214653 21/88 (24%)
IGc2 198..258 CDD:197706 16/70 (23%)
I-set 273..360 CDD:254352 14/65 (22%)
Ig 290..359 CDD:143165 12/48 (25%)
FN3 <466..524 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.