Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291422.1 | Gene: | ush2a / 568982 | ZFINID: | ZDB-GENE-060503-794 | Length: | 5243 | Species: | Danio rerio |
Alignment Length: | 511 | Identity: | 91/511 - (17%) |
---|---|---|---|
Similarity: | 147/511 - (28%) | Gaps: | 218/511 - (42%) |
- Green bases have known domain annotations that are detailed below.
Fly 42 ASASPGGGKTVA----------ATMTTPASEPSVRHINQNLIMSQSKEGEPVPVP--QPYAQ-SA 93
Fly 94 ASAGGSSITSFDSTNVI--------DGQSQP-----TPTHLQEAVLQTHSHSRIQAKDTAGPYPI 145
Fly 146 PVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHI-------- 202
Fly 203 GEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPT 267
Fly 268 ---SIFLHLSVVEARAEITGPP-------IRYLTP--------------GSTLRLQCRVV----- 303
Fly 304 -----------QNTEASEYIFWYHDNRMIN-----YDIDRGIN----VSTEPDFQSSE-LT---- 343
Fly 344 --------------IQRTRREHSGNFTCVASNTQPA----------------------------- 365
Fly 366 --------------------SVLVHIFKGDNPAAMYH----------GHVGGSTKT 391 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 20/106 (19%) |
IG_like | 182..262 | CDD:214653 | 15/87 (17%) | ||
IG_like | 285..362 | CDD:214653 | 22/141 (16%) | ||
IGc2 | 292..361 | CDD:197706 | 19/126 (15%) | ||
ush2a | XP_009291422.1 | Laminin_G_3 | 160..297 | CDD:290121 | |
Laminin_N | 307..528 | CDD:295486 | |||
EGF_Lam | 529..577 | CDD:238012 | |||
EGF_Lam | 586..638 | CDD:238012 | |||
Laminin_EGF | 653..703 | CDD:278482 | |||
Laminin_EGF | 706..756 | CDD:278482 | |||
EGF_Lam | 759..797 | CDD:214543 | |||
Laminin_EGF | 808..857 | CDD:278482 | |||
EGF_Lam | 859..912 | CDD:238012 | |||
EGF_Lam | 913..963 | CDD:238012 | |||
EGF_Lam | 965..1014 | CDD:238012 | |||
EGF_Lam | 1015..1064 | CDD:238012 | |||
FN3 | 1177..1253 | CDD:238020 | |||
FN3 | 1264..1375 | CDD:238020 | |||
FN3 | 1386..1469 | CDD:214495 | |||
LamG | 1537..1699 | CDD:238058 | |||
LamG | 1737..1890 | CDD:238058 | |||
FN3 | 1981..2071 | CDD:238020 | |||
FN3 | 2163..2253 | CDD:238020 | |||
FN3 | 2258..2341 | CDD:238020 | |||
FN3 | 2352..2443 | CDD:238020 | 19/81 (23%) | ||
FN3 | 2447..2544 | CDD:238020 | 23/133 (17%) | ||
FN3 | 2547..2633 | CDD:238020 | 19/97 (20%) | ||
FN3 | 2635..2733 | CDD:238020 | 15/98 (15%) | ||
FN3 | 2743..2807 | CDD:238020 | 6/63 (10%) | ||
FN3 | 2830..2932 | CDD:238020 | |||
fn3 | 2939..3014 | CDD:278470 | |||
FN3 | 3032..>3099 | CDD:238020 | |||
FN3 | 3542..3611 | CDD:238020 | |||
FN3 | 3615..3701 | CDD:238020 | |||
fn3 | 3718..3784 | CDD:278470 | |||
FN3 | 3801..3887 | CDD:238020 | |||
FN3 | 3908..3971 | CDD:238020 | |||
FN3 | 3996..4086 | CDD:238020 | |||
FN3 | 4186..4284 | CDD:238020 | |||
fn3 | 4288..4366 | CDD:278470 | |||
FN3 | 4382..4465 | CDD:238020 | |||
FN3 | 4470..4553 | CDD:238020 | |||
FN3 | 4555..4653 | CDD:238020 | |||
FN3 | 4679..4753 | CDD:238020 | |||
fn3 | 4760..4830 | CDD:278470 | |||
FN3 | 4864..4955 | CDD:238020 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |