DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and igsf9ba

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_009289969.2 Gene:igsf9ba / 567389 ZFINID:ZDB-GENE-060503-729 Length:1475 Species:Danio rerio


Alignment Length:319 Identity:66/319 - (20%)
Similarity:110/319 - (34%) Gaps:95/319 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ASAGGSSITSFDSTNVIDGQSQP--------------------TPTHLQ-----------EAVLQ 127
            |.||.|.:...|.::.::||..|                    .|.|:.           :|.||
Zfish    35 ARAGESVVLGCDVSHPLNGQQTPYVVEWFKFGVPIPFFINFRFYPPHVDPEYAGRASLHGKASLQ 99

  Fly   128 THSHSRIQAKDTAGPYPIPV----HRPEPVEN----HLEANNGIEGGMESLFGTPMYFGTENSTV 184
            .   .:::::| .|.|...|    .:.:...|    ||..|            .|..|.......
Zfish   100 I---EQVRSED-QGWYECRVLMLEQQYDTFHNGSWVHLTVN------------APPTFSDTPPQY 148

  Fly   185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249
            |..:.|.:..:.||.....:.||:|:|:.|               :.::|......|.:|.::.:
Zfish   149 VEAREGGSITLTCTAFGNPKPVVTWLREGD---------------QLTSTRKYTVSDGSLTVQAI 198

  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNT----EASE 310
            ...|.|.|.|:  .|......||.:    |..:.|||. .:||...:.:  .:.||.    :|..
Zfish   199 TREDRGAYSCR--AHSDQGEALHTT----RLLVQGPPY-IVTPPENITV--NISQNAQFTCQAEA 254

  Fly   311 Y-------IFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNT 362
            |       .:|..||.....|:...:.:     |....|.|.|.:.|.:|.:||..||:
Zfish   255 YPGNLTYTWYWEEDNVYFKNDLKLRVRI-----FIDGTLIIYRVKPEDAGKYTCSPSNS 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 19/95 (20%)
IG_like 182..262 CDD:214653 16/79 (20%)
IG_like 285..362 CDD:214653 21/87 (24%)
IGc2 292..361 CDD:197706 17/79 (22%)
igsf9baXP_009289969.2 IG 30..115 CDD:214652 16/83 (19%)
I-set 139..225 CDD:254352 21/106 (20%)
I-set 229..321 CDD:333254 21/88 (24%)
Ig 345..415 CDD:325142
Ig 438..503 CDD:319273
FN3 511..606 CDD:238020
FN3 622..706 CDD:238020
Atrophin-1 <924..1361 CDD:331285
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.