DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and sdk1a

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_009297968.1 Gene:sdk1a / 558391 ZFINID:ZDB-GENE-081104-374 Length:2245 Species:Danio rerio


Alignment Length:174 Identity:45/174 - (25%)
Similarity:68/174 - (39%) Gaps:17/174 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249
            :|...||.|...|.|....:..:.|  ::|..:|..|....   .||:..     |...|||:.|
Zfish   519 ITVTDGAVAAFTCRVSGAPKPAIVW--RRDTQILASGSVQI---PRFTLL-----ESGGLQIQPV 573

  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPI-RYLTPGSTLRLQCRVVQNTEASEYIF 313
            .|:|.|.|.|..:.............|.:|..|:.||. |.:..|:|..|:|....:........
Zfish   574 VLQDTGNYTCYAANSEGAINASASLTV
WSRTSISSPPTDRRVIKGTTAILECGATHDPRVGVRYV 638

  Fly   314 WYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTC 357
            |..|..::::  .||..:|    .|...|.|.:|.....||:||
Zfish   639 WKKDEELVSH--SRGGRIS----LQEGSLHISQTWSGDIGNYTC 676

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 22/90 (24%)
IG_like 182..262 CDD:214653 22/76 (29%)
IG_like 285..362 CDD:214653 20/74 (27%)
IGc2 292..361 CDD:197706 17/66 (26%)
sdk1aXP_009297968.1 I-set 125..208 CDD:254352
Ig 125..204 CDD:299845
IG_like 222..302 CDD:214653
Ig 236..287 CDD:299845
Ig_3 322..394 CDD:290638
I-set 323..412 CDD:254352
I-set 416..505 CDD:254352
Ig 436..500 CDD:299845
I-set 510..600 CDD:254352 22/90 (24%)
Ig 527..600 CDD:299845 19/82 (23%)
I-set 605..693 CDD:254352 21/78 (27%)
Ig 610..693 CDD:299845 19/73 (26%)
FN3 697..788 CDD:238020
fn3 800..886 CDD:278470
FN3 901..997 CDD:238020
FN3 1002..1090 CDD:238020
FN3 1100..1196 CDD:238020
FN3 1206..1301 CDD:238020
FN3 1308..1397 CDD:238020
FN3 1408..1501 CDD:238020
FN3 1507..1602 CDD:238020
FN3 1616..1722 CDD:238020
FN3 1732..1825 CDD:238020
FN3 1830..1919 CDD:238020
FN3 1931..2021 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.