DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and igsf9b

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_686205.6 Gene:igsf9b / 553348 ZFINID:ZDB-GENE-060810-28 Length:2021 Species:Danio rerio


Alignment Length:249 Identity:55/249 - (22%)
Similarity:89/249 - (35%) Gaps:72/249 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   184 VVTTQIGATAHVPCTVHHIGEG----------VVSWIRKKDYH---LLTVGLTTYSSDERFSATH 235
            ||..::|..|.:.|::....||          ||.|:| ..|:   |:..|..|......:.. .
Zfish    29 VVQGRVGGFAELGCSLTPPSEGATTPNLFPLHVVEWVR-LGYNVPILIKFGSYTPRVHPNYKG-R 91

  Fly   236 LKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTS--------IFLHLSVVEARAEITGPPIRYLTP 292
            :..|...:|.::.:.|.|.|.:||::.....||        .||         .||.||:...||
Zfish    92 VSLSRGASLMVEKLTLEDEGWFECRILLLDRTSDEFQNGTW
NFL---------SITAPPVFIKTP 147

  Fly   293 --------GSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRR 349
                    |.:|.|.|....|.:.:  |.|   .:.::     ......|....:..|::.:..|
Zfish   148 PPFLEVLLGESLTLHCDAHGNPKPT--IIW---RKYLS-----AAEKQEEIQVLNETLSLSKVTR 202

  Fly   350 EHSGNFTCVASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIII 403
            |.:|.:.|..||::                      |..|.:||.|:....|||
Zfish   203 ETAGIYKCHVSNSE----------------------GNLTHSTQLQVKGPPIII 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 26/112 (23%)
IG_like 182..262 CDD:214653 22/90 (24%)
IG_like 285..362 CDD:214653 18/84 (21%)
IGc2 292..361 CDD:197706 14/76 (18%)
igsf9bXP_686205.6 Ig 27..132 CDD:299845 24/104 (23%)
IG_like 148..227 CDD:214653 19/110 (17%)
IGc2 156..217 CDD:197706 15/92 (16%)
Ig 237..323 CDD:299845
IG_like 237..323 CDD:214653
Ig 345..411 CDD:143165
IG_like 435..507 CDD:214653
IGc2 437..496 CDD:197706
FN3 512..603 CDD:238020
FN3 621..709 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.