DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and iglon5

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001017775.2 Gene:iglon5 / 550472 ZFINID:ZDB-GENE-050417-297 Length:332 Species:Danio rerio


Alignment Length:298 Identity:66/298 - (22%)
Similarity:100/298 - (33%) Gaps:117/298 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 GATA----HVPCTVHHI-GEGVV------------SWIRKKDYHLLTVGLTTYSSDERFSATHLK 237
            ||.|    |:|..:..: ||.||            :|:.:.  ::|..|...:|.|.|.|..: .
Zfish    23 GAQAAEFGHLPDNITVLEGESVVLRCKIDEEVTHKAWLNRS--NILFTGTDKWSLDSRVSLEN-N 84

  Fly   238 HSEDWTLQIKFVQLRDAGVYEC--QVSTHPPTSIFLHLSVVEAR--------------------- 279
            ::.|::::|:.|.:.|.|.|.|  |....|.|:....:..|.||                     
Zfish    85 NNSDFSIRIERVMVADEGPYTCSFQARNKPRTAHVYLIVQVPARIVNISQDKSVNEGEDVNLFCL 149

  Fly   280 ------------------------AEIT------------------GPP--------IRY---LT 291
                                    .|||                  .||        :.|   :|
Zfish   150 AVGRPEPTITWKDFKYGLLNEGEFLEITEIKRHQAEDFECITNNGVAPPDTRKVKVTVNYPPIIT 214

  Fly   292 P--------GSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTR 348
            .        |.|..|:|..:....||  ..||.|:|. ..:.|..:.:..|.  ..|.|......
Zfish   215 DVKNMPAQVGKTAILRCEAMAVPTAS--FEWYRDDRR-PVESDNTLKIKNEK--TRSLLLFTNVT 274

  Fly   349 REHSGNFTCVASN---TQPASVLVHIFKGDNPAAMYHG 383
            .:|.||:||.|||   ...||:|  :|:   |.|:|.|
Zfish   275 EKHFGNYTCFASNRLGASNASML--LFR---PGAVYGG 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 26/104 (25%)
IG_like 182..262 CDD:214653 24/90 (27%)
IG_like 285..362 CDD:214653 26/98 (27%)
IGc2 292..361 CDD:197706 20/76 (26%)
iglon5NP_001017775.2 IG_like 33..123 CDD:214653 22/92 (24%)
Ig 35..123 CDD:299845 21/90 (23%)
Ig 125..>183 CDD:299845 6/57 (11%)
I-set 128..207 CDD:254352 6/78 (8%)
IG_like 217..298 CDD:214653 25/87 (29%)
ig 223..296 CDD:278476 23/77 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.