Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_017451354.1 | Gene: | Ntm / 50864 | RGDID: | 620958 | Length: | 367 | Species: | Rattus norvegicus |
Alignment Length: | 196 | Identity: | 52/196 - (26%) |
---|---|---|---|
Similarity: | 87/196 - (44%) | Gaps: | 40/196 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 185 VTTQIGATAHVPCTV-HHIGEGVVSWIRKKDYHLLTVGLTTYSSDER---FSATHLKHSEDWTLQ 245
Fly 246 IKFVQLRDAGVYECQVST--HPPTSIFLHL------SVVEARAEITGPPIRYLTPGSTLRLQCRV 302
Fly 303 VQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASV 367
Fly 368 L 368 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 29/102 (28%) |
IG_like | 182..262 | CDD:214653 | 21/80 (26%) | ||
IG_like | 285..362 | CDD:214653 | 17/76 (22%) | ||
IGc2 | 292..361 | CDD:197706 | 16/68 (24%) | ||
Ntm | XP_017451354.1 | Ig | 44..132 | CDD:416386 | 29/95 (31%) |
Ig strand A' | 44..49 | CDD:409353 | 2/3 (67%) | ||
Ig strand B | 51..59 | CDD:409353 | 2/7 (29%) | ||
CDR1 | 59..63 | CDD:409353 | 0/3 (0%) | ||
FR2 | 64..70 | CDD:409353 | 2/7 (29%) | ||
Ig strand C | 64..70 | CDD:409353 | 2/7 (29%) | ||
CDR2 | 71..83 | CDD:409353 | 2/13 (15%) | ||
Ig strand C' | 72..76 | CDD:409353 | 0/5 (0%) | ||
Ig strand C' | 80..83 | CDD:409353 | 0/2 (0%) | ||
FR3 | 84..118 | CDD:409353 | 11/37 (30%) | ||
Ig strand D | 87..94 | CDD:409353 | 2/6 (33%) | ||
Ig strand E | 97..103 | CDD:409353 | 1/9 (11%) | ||
Ig strand F | 110..118 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 119..123 | CDD:409353 | 1/3 (33%) | ||
Ig strand G | 123..132 | CDD:409353 | 5/9 (56%) | ||
FR4 | 125..132 | CDD:409353 | 4/7 (57%) | ||
Ig_3 | 136..205 | CDD:404760 | 19/87 (22%) | ||
Ig strand A' | 144..148 | CDD:409353 | 1/9 (11%) | ||
Ig strand B | 151..160 | CDD:409353 | 2/8 (25%) | ||
Ig strand F | 197..205 | CDD:409353 | 3/7 (43%) | ||
Ig | 223..307 | CDD:416386 | |||
putative Ig strand A | 223..229 | CDD:409353 | |||
Ig strand B | 239..243 | CDD:409353 | |||
Ig strand C | 252..256 | CDD:409353 | |||
Ig strand E | 278..282 | CDD:409353 | |||
Ig strand F | 292..297 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |