DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and tutl

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:420 Identity:85/420 - (20%)
Similarity:137/420 - (32%) Gaps:126/420 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 GICDHTASASPGGGKTVAATMTTPASEPSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGG-- 98
            |:|     |..|..:...|..|...:|.|         ..|.::.:|:.:|:   |.|:...|  
  Fly     2 GVC-----ADLGSHRWCRALSTQHNTEKS---------KEQQQQSQPLEIPE---QRASKCRGDI 49

  Fly    99 --SSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHR-----PEPVENH 156
              ::.|:..::..:......|.....:...:..|..|.:.....    :|:.|     |.|....
  Fly    50 DRTTTTTIPASKTLTASPAKTAAFTVKTTRRRRSRRRAEGSSIC----VPIRRGQGSTPTPTIQV 110

  Fly   157 LE----------ANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIR 211
            |:          |.|.      .....|     |::..:|..:|......|.|....:..|.::.
  Fly   111 LQFVLVSLLALLAKNA------QAHNIP-----EDAVHITAILGEGVIFNCHVEFPNDHPVPYVL 164

  Fly   212 KKDYHLLTVG-----LTTYSS-----DERFSATHLKHSED-----WTLQIKFVQLRDAGVYECQV 261
            :.|..:...|     ...|.|     :|.:.....:.|:|     .:|.:..::..|.|.|||:|
  Fly   165 QWDKKVSETGSDLPIYIWYESYPEHIEEGYKGRVSRVSQDSPFGSASLNLTNIRESDQGWYECKV 229

  Fly   262 STHPPTSIFL-------------HLSV-VEARAEITGPPIRYLTPGSTLRLQCRVVQNTEASEYI 312
                   :||             ||.| ...|..:|...|.|:..|.::.|.|: ...|...| |
  Fly   230 -------VFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVNLGDSIILNCQ-ADGTPTPE-I 285

  Fly   313 FWYHDNRMINYDIDRGI-NVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKGDN 376
            .||.|...::.....|| |..|       ||.|...|.|..|.:||:|.|.:             
  Fly   286 LWYKDANPVDPSPTVGIFNDGT-------ELRISTIRHEDIGEYTCIARNGE------------- 330

  Fly   377 PAAMYHGHVGGSTKTTQSQLHMIMIIIASG 406
                  |.|.          |...:|||.|
  Fly   331 ------GQVS----------HTARVIIAGG 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 25/124 (20%)
IG_like 182..262 CDD:214653 18/94 (19%)
IG_like 285..362 CDD:214653 24/77 (31%)
IGc2 292..361 CDD:197706 22/69 (32%)
tutlNP_001303307.1 V-set 137..250 CDD:284989 23/119 (19%)
IG_like 137..229 CDD:214653 18/91 (20%)
I-set 253..341 CDD:254352 30/125 (24%)
IGc2 268..331 CDD:197706 23/90 (26%)
I-set 346..437 CDD:254352
Ig 349..437 CDD:299845
Ig 459..530 CDD:299845
IG_like 549..628 CDD:214653
IGc2 551..617 CDD:197706
FN3 633..725 CDD:238020
FN3 786..874 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.