Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_031751706.1 | Gene: | cadm2 / 448238 | XenbaseID: | XB-GENE-998536 | Length: | 441 | Species: | Xenopus tropicalis |
Alignment Length: | 232 | Identity: | 50/232 - (21%) |
---|---|---|---|
Similarity: | 91/232 - (39%) | Gaps: | 58/232 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 179 TENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDE---RFSATHLKHSE 240
Fly 241 DW---TLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSV--VEARAEITGPPIRYLTP---GSTLR 297
Fly 298 LQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELT-IQRTRREHSGNFTCVASN 361
Fly 362 TQPASVLVHIFKGD--NPAAMYHGHVGGSTKTTQSQL 396 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 26/103 (25%) |
IG_like | 182..262 | CDD:214653 | 21/85 (25%) | ||
IG_like | 285..362 | CDD:214653 | 13/80 (16%) | ||
IGc2 | 292..361 | CDD:197706 | 13/72 (18%) | ||
cadm2 | XP_031751706.1 | IgV_1_Necl-3 | 34..129 | CDD:409498 | 26/102 (25%) |
Ig strand B | 48..52 | CDD:409498 | 0/3 (0%) | ||
Ig strand C | 61..65 | CDD:409498 | 0/3 (0%) | ||
Ig strand E | 95..99 | CDD:409498 | 0/3 (0%) | ||
Ig strand F | 109..114 | CDD:409498 | 2/4 (50%) | ||
Ig strand G | 121..124 | CDD:409498 | 0/2 (0%) | ||
IgI_2_Necl-3 | 128..231 | CDD:409467 | 24/130 (18%) | ||
Ig strand B | 150..154 | CDD:409467 | 1/3 (33%) | ||
Ig strand C | 164..168 | CDD:409467 | 1/4 (25%) | ||
Ig strand E | 194..198 | CDD:409467 | 0/10 (0%) | ||
Ig strand F | 208..213 | CDD:409467 | 0/4 (0%) | ||
Ig strand G | 224..227 | CDD:409467 | 0/1 (0%) | ||
IGc2 | 248..311 | CDD:197706 | |||
Ig strand B | 250..259 | CDD:409353 | |||
Ig strand C | 265..271 | CDD:409353 | |||
Ig strand C' | 274..277 | CDD:409353 | |||
Ig strand D | 280..285 | CDD:409353 | |||
Ig strand E | 286..293 | CDD:409353 | |||
Ig strand F | 300..308 | CDD:409353 | |||
Ig strand G | 311..321 | CDD:409353 | |||
4.1m | 394..412 | CDD:128590 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 82 | 1.000 | Inparanoid score | I5030 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.960 |