DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and DIP-gamma

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_651649.1 Gene:DIP-gamma / 43417 FlyBaseID:FBgn0039617 Length:413 Species:Drosophila melanogaster


Alignment Length:207 Identity:51/207 - (24%)
Similarity:82/207 - (39%) Gaps:28/207 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 PMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKH 238
            |.:.|..|:  ||...|..|.:.|:|.::|:..|.|:|..|..:|.:.....:.:.|.|..| :.
  Fly    39 PEFIGFINN--VTYPAGREAILACSVRNLGKNKVGWLRASDQTVLALQGRVVTHNARISVMH-QD 100

  Fly   239 SEDWTLQIKFVQLRDAGVYECQVSTHP------------PTSIFLHLSVVEARAEITGPPIRYLT 291
            ...|.|:|..::..|.|.|.||::|.|            |..|...    |:.|::.      :.
  Fly   101 MHTWKLKISKLRESDRGCYMCQINTSPMKKQVGCIDVQVPPDIINE----ESSADLA------VQ 155

  Fly   292 PGSTLRLQCRVVQNTEASEYIFW-YHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNF 355
            .|....|.|:...|.:..  :.| ..|..||.........:.....:..|.|.:.|..|...|.:
  Fly   156 EGEDATLTCKATGNPQPR--VTWRREDGEMILIRKPGSRELMKVESYNGSSLRLLRLERRQMGAY 218

  Fly   356 TCVASNTQPASV 367
            .|:|||..|.:|
  Fly   219 LCIASNDVPPAV 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 28/107 (26%)
IG_like 182..262 CDD:214653 23/79 (29%)
IG_like 285..362 CDD:214653 16/77 (21%)
IGc2 292..361 CDD:197706 15/69 (22%)
DIP-gammaNP_651649.1 IG_like 47..139 CDD:214653 25/94 (27%)
Ig 47..129 CDD:299845 25/84 (30%)
Ig 140..238 CDD:299845 23/103 (22%)
IG_like 247..355 CDD:214653
Ig 256..351 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 41 1.000 Domainoid score I12439
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.