Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_651649.1 | Gene: | DIP-gamma / 43417 | FlyBaseID: | FBgn0039617 | Length: | 413 | Species: | Drosophila melanogaster |
Alignment Length: | 207 | Identity: | 51/207 - (24%) |
---|---|---|---|
Similarity: | 82/207 - (39%) | Gaps: | 28/207 - (13%) |
- Green bases have known domain annotations that are detailed below.
Fly 174 PMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKH 238
Fly 239 SEDWTLQIKFVQLRDAGVYECQVSTHP------------PTSIFLHLSVVEARAEITGPPIRYLT 291
Fly 292 PGSTLRLQCRVVQNTEASEYIFW-YHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNF 355
Fly 356 TCVASNTQPASV 367 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 28/107 (26%) |
IG_like | 182..262 | CDD:214653 | 23/79 (29%) | ||
IG_like | 285..362 | CDD:214653 | 16/77 (21%) | ||
IGc2 | 292..361 | CDD:197706 | 15/69 (22%) | ||
DIP-gamma | NP_651649.1 | IG_like | 47..139 | CDD:214653 | 25/94 (27%) |
Ig | 47..129 | CDD:299845 | 25/84 (30%) | ||
Ig | 140..238 | CDD:299845 | 23/103 (22%) | ||
IG_like | 247..355 | CDD:214653 | |||
Ig | 256..351 | CDD:299845 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 41 | 1.000 | Domainoid score | I12439 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |