DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and klg

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_524454.2 Gene:klg / 42707 FlyBaseID:FBgn0017590 Length:545 Species:Drosophila melanogaster


Alignment Length:182 Identity:46/182 - (25%)
Similarity:78/182 - (42%) Gaps:34/182 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   189 IGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRD 253
            :|.|..:||.|.::|..|:.|  ::..::||......:.|||     ::..:.:.|:|..::.:|
  Fly   114 VGDTLVLPCQVENLGNFVLLW--RRGTNVLTASNIMVTRDER-----VRLIDGYNLEISDLEPQD 171

  Fly   254 AGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTP---------GSTLRLQCRVVQNTEAS 309
            ||.|.||:|..      ::...|.. .||..||.....|         |..:.|:|:...|...|
  Fly   172 AGDYVCQISDK------INRDQVHT-VEILV
PPSVRAIPTSGQLQARKGGPITLECKGSGNPVPS 229

  Fly   310 EYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASN 361
              |:|...:         |.|.||........||:::..|:.:|.:.|.|.|
  Fly   230 --IYWTKKS---------GANKSTARIGDGPILTLEKLERQQAGVYQCTADN 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 22/86 (26%)
IG_like 182..262 CDD:214653 21/72 (29%)
IG_like 285..362 CDD:214653 21/86 (24%)
IGc2 292..361 CDD:197706 18/77 (23%)
klgNP_524454.2 DUF1370 63..>124 CDD:284518 4/9 (44%)
IG_like 109..195 CDD:214653 25/94 (27%)
Ig 118..191 CDD:143165 21/86 (24%)
IG_like 205..274 CDD:214653 18/77 (23%)
IGc2 213..273 CDD:197706 18/69 (26%)
IGc2 301..367 CDD:197706
FN3 392..486 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.