DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and dpr5

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_650080.3 Gene:dpr5 / 41381 FlyBaseID:FBgn0037908 Length:336 Species:Drosophila melanogaster


Alignment Length:298 Identity:101/298 - (33%)
Similarity:154/298 - (51%) Gaps:14/298 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 AASAGGSSITSFDST----NVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHRPEPV 153
            |..|..:|.|:.:|:    .||.....|...|   .:|..:..:.:.......|......|....
  Fly     6 AVRATFTSTTATESSPLIGKVISNSRAPQIAH---EMLVEYFMALLVIMGLTAPVDKQSRRSSQY 67

  Fly   154 ENHL----EANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKD 214
            ..||    |.:|.|....:::  .|::..|.:..|:.. :|.||.:.|.|.|:|:..|||||::|
  Fly    68 FGHLAAAEELSNLIPDNYDAI--DPVFDNTTDREVIAA-LGTTARLHCRVRHLGDRAVSWIRQRD 129

  Fly   215 YHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEAR 279
            .|:||:|:.||::|:||.|.|:.:|::|.|:|..||.||||||||||||.|..|:...|.||.::
  Fly   130 LHILTIGIMTYTNDQRFLARHIDNSDEWVLKIVSVQQRDAGVYECQVSTEPKISLAYKLVVVTSK 194

  Fly   280 AEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTI 344
            |:|......::..||.:.|.|...|......::.|:.|..:::.....||.|.:|...::|.|.|
  Fly   195 AQILANRELFIQSGSDINLTCIAPQAPGPYTHMLWHKDTELVSDSARGGIRVESEQQMKTSNLVI 259

  Fly   345 QRTRREHSGNFTCVASNTQPASVLVHIFKGDNPAAMYH 382
            .|.:...|||:||.|.|:...||.|||.|.:..|||.|
  Fly   260 SRVQHTDSGNYTCSADNSNSDSVFVHIIKSEQHAAMQH 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 46/95 (48%)
IG_like 182..262 CDD:214653 40/79 (51%)
IG_like 285..362 CDD:214653 21/76 (28%)
IGc2 292..361 CDD:197706 21/68 (31%)
dpr5NP_650080.3 V-set 95..191 CDD:284989 47/96 (49%)
IG_like 98..179 CDD:214653 42/81 (52%)
IG_like 206..278 CDD:214653 22/71 (31%)
Ig 211..278 CDD:143165 20/66 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.