DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Ama

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_731114.2 Gene:Ama / 40831 FlyBaseID:FBgn0000071 Length:341 Species:Drosophila melanogaster


Alignment Length:224 Identity:53/224 - (23%)
Similarity:95/224 - (42%) Gaps:36/224 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   167 MESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRK---KDYHLLTVGLTTYSS- 227
            ::|:...|:.  ::.|..|...:|.:....|||..:|:..|||.::   .|.:.:.:.:....| 
  Fly    26 LDSVLSAPVI--SQISKDVVASVGDSVEFNCTVEEVGQLSVSWAKRPSESDTNSVVLSMRNILSL 88

  Fly   228 -DERFSATHLK----HSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPI 287
             |:|::.|..:    .|..:|.:|:.:::.|.|.|||||.......:...||:     :|..||:
  Fly    89 PDQRYNVTVTEGPKTGSAIYTFRIQNIEVSDMGPYECQVLVSATEKVTKKLSL-----QIKTPPV 148

  Fly   288 --------RYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTI 344
                    ..:|.|..|.|.|..  |......|.|..::..:   :..|.::..||     .|.|
  Fly   149 IAENTPKSTLVTEGQNLELTCHA--NGFPKPTISWAREHNAV---MPAGGHLLAEP-----TLRI 203

  Fly   345 QRTRREHSGNFTCVASN--TQPASVLVHI 371
            :...|...|.:.|:|.|  .||...|:.:
  Fly   204 RSVHRMDRGGYYCIAQNGEGQPDKRLIRV 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 27/104 (26%)
IG_like 182..262 CDD:214653 24/88 (27%)
IG_like 285..362 CDD:214653 20/86 (23%)
IGc2 292..361 CDD:197706 16/68 (24%)
AmaNP_731114.2 I-set 33..143 CDD:254352 28/116 (24%)
Ig 37..127 CDD:299845 23/89 (26%)
IG_like 154..234 CDD:214653 21/89 (24%)
IGc2 161..223 CDD:197706 17/71 (24%)
I-set 254..330 CDD:254352
IGc2 254..322 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.