Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001305844.1 | Gene: | LSAMP / 4045 | HGNCID: | 6705 | Length: | 361 | Species: | Homo sapiens |
Alignment Length: | 270 | Identity: | 62/270 - (22%) |
---|---|---|---|
Similarity: | 97/270 - (35%) | Gaps: | 98/270 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 GTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDW 242
Fly 243 TLQIKFVQLRDAGVYECQVST-HPPTSIFLHLSV--------------VEARAEIT------GPP 286
Fly 287 -----IRYLTP---------------GSTL----RLQCRVVQNTEASEY---------------- 311
Fly 312 ------------------------IFWYHDNRMINYDIDRGINV-STEPDFQSSELTIQRTRREH 351
Fly 352 SGNFTCVASN 361 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 28/110 (25%) |
IG_like | 182..262 | CDD:214653 | 21/79 (27%) | ||
IG_like | 285..362 | CDD:214653 | 29/142 (20%) | ||
IGc2 | 292..361 | CDD:197706 | 24/128 (19%) | ||
LSAMP | NP_001305844.1 | Ig | 38..128 | CDD:386229 | 28/96 (29%) |
Ig | 132..215 | CDD:386229 | 11/82 (13%) | ||
Ig_3 | 219..294 | CDD:372822 | 20/79 (25%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |