DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and LSAMP

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001305844.1 Gene:LSAMP / 4045 HGNCID:6705 Length:361 Species:Homo sapiens


Alignment Length:270 Identity:62/270 - (22%)
Similarity:97/270 - (35%) Gaps:98/270 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 GTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDW 242
            ||:|   :|.:.|.||.:.|.|.. ....|:|:.:..  ::..|...:|.|.|.. ...:||.::
Human    37 GTDN---ITVRQGDTAILRCVVED-KNSKVAWLNRSG--IIFAGHDKWSLDPRVE-LEKRHSLEY 94

  Fly   243 TLQIKFVQLRDAGVYECQVST-HPPTSIFLHLSV--------------VEARAEIT------GPP 286
            :|:|:.|.:.|.|.|.|.|.| |.|.:..::|.|              |...:.:|      |.|
Human    95 SLRIQKVDVYDEGSYTCSVQTQHEPKTSQVYLIVQVPPKISNISSDVTVNEGSNVTLVCMANGRP 159

  Fly   287 -----IRYLTP---------------GSTL----RLQCRVVQNTEASEY---------------- 311
                 .|:|||               |.|.    :.:|:......:::.                
Human   160 EPVITWRHLTPTGREFEGEEEYLEILGITREQSGKYECKAANEVSSADVKQVKVTVNYPPTITES 224

  Fly   312 ------------------------IFWYHDNRMINYDIDRGINV-STEPDFQSSELTIQRTRREH 351
                                    ..||.|:..||  ...|:.: |||   ..|.||:.....||
Human   225 KSNEATTGRQASLKCEASAVPAPDFEWYRDDTRIN--SANGLEIKSTE---GQSSLTVTNVTEEH 284

  Fly   352 SGNFTCVASN 361
            .||:||||:|
Human   285 YGNYTCVAAN 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 28/110 (25%)
IG_like 182..262 CDD:214653 21/79 (27%)
IG_like 285..362 CDD:214653 29/142 (20%)
IGc2 292..361 CDD:197706 24/128 (19%)
LSAMPNP_001305844.1 Ig 38..128 CDD:386229 28/96 (29%)
Ig 132..215 CDD:386229 11/82 (13%)
Ig_3 219..294 CDD:372822 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.