DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and dpr20

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_612066.1 Gene:dpr20 / 38101 FlyBaseID:FBgn0035170 Length:525 Species:Drosophila melanogaster


Alignment Length:448 Identity:118/448 - (26%)
Similarity:197/448 - (43%) Gaps:96/448 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 TVAATMTTPASEPSVR-HINQNLIMSQSK--------EGEPVPVPQPYAQSAA------SAGGSS 100
            |.....||||:.|:.. ||:..:...:|.        :|:.| :|:....:.|      |..|..
  Fly    80 TKVPLQTTPATPPTAHAHIHNQVSTLRSSYEDSDDGVDGDYV-IPESQTSTVAILDQDSSMKGQD 143

  Fly   101 ITSFD---STNVIDGQSQPTPT-HLQEAVLQTHSHSRIQA------KDTAGPYPIPVHR-----P 150
            :.|..   .:..:..:|.|..: |.:.|..|......:.|      ..|:...|...:.     .
  Fly   144 MESLSLQAGSGTVSPKSSPDSSGHKKNASFQQIGSQNVNALVPATVATTSSGLPSSSNASLATPT 208

  Fly   151 EPVENH-----------LEANNGIEGGMES-------LFGTPMYFGTEN---------------- 181
            ||..|.           :::.:.:..|.::       :|.|   |.:.|                
  Fly   209 EPARNRSTGLVRNSAVKVDSKHPLSKGQKTDAPMLNYIFDT---FSSANKHHHHDQRYGPHFEDV 270

  Fly   182 -----STVVTTQIGATAHVPCTVHHIGEGVVSWIRK------KD----YHLLTVGLTTYSSDERF 231
                 :|.:|.|.|::.|:.|.:..:.:..|||:|.      ||    ..|||||:.||:.|:|:
  Fly   271 QRIGQATNLTVQAGSSIHLNCRISLLQDKTVSWVRHNTQDEGKDNGNALDLLTVGMHTYTGDKRY 335

  Fly   232 SATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEI---TGPPI--RYLT 291
            . ...::..:|.|:|..|:..|..:||||:|||||..|.::|.|...:..|   .|.|:  :|..
  Fly   336 K-MEFQYPNNWRLKITNVKKDDEAIYECQISTHPPRVIQINLHVNAPKVMIVDEVGDPLQEKYYE 399

  Fly   292 PGSTLRLQCRVVQNTE-ASEYIFWYHDNRMINYDIDR-GINVSTE--PDFQSSELTIQRTRREHS 352
            ..|||:|.| ||:|.. .|..:||.|.:.::|||:.| |::|.||  .|..:|.|:|.:..:..|
  Fly   400 IDSTLQLSC-VVRNVAMTSSVVFWKHMDNILNYDVTRGGVSVKTELMEDGANSTLSIAKISKTDS 463

  Fly   353 GNFTCVASNTQPASVLVHIFKGDNPAAMYHGHVGG--STKTTQSQLHMIMIIIASGYR 408
            ||:||..|..|..:::|||..|::.|.::||...|  ||......||.:.:::.:..|
  Fly   464 GNYTCSISEFQNFTIVVHILNGESFAELHHGGAVGWHSTWWNMVMLHAMALLVLNSLR 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 38/126 (30%)
IG_like 182..262 CDD:214653 30/89 (34%)
IG_like 285..362 CDD:214653 32/82 (39%)
IGc2 292..361 CDD:197706 29/72 (40%)
dpr20NP_612066.1 IG_like 278..365 CDD:214653 29/87 (33%)
Ig 279..378 CDD:299845 36/99 (36%)
Ig 400..471 CDD:299845 29/71 (41%)
IG_like 402..480 CDD:214653 31/78 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.