DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and CG13506

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001286718.1 Gene:CG13506 / 37556 FlyBaseID:FBgn0034723 Length:503 Species:Drosophila melanogaster


Alignment Length:165 Identity:32/165 - (19%)
Similarity:67/165 - (40%) Gaps:25/165 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   243 TLQIKFVQLRDAGVYECQ-----VSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRV 302
            ::.::.|...|:..|.|:     |..|....:...||::....:||... :....|...:|:||.
  Fly   129 SILLRNVSPEDSDDYYCE
ILPQRVRQHTALRVGARLSILCDDRDITDRS-QTFRQGDHHKLECRT 192

  Fly   303 VQNTEASEYIFWYHDNRMINYDIDRGINVSTEP---DFQSSELTIQRTRREHSGNFTCVA--SNT 362
                       :..||..|.:..:   :::.:|   |.|:..:.:.....:::|::.|:|  .:.
  Fly   193 -----------YLPDNATIKWSFN---DLNGQPSSVDNQNGVIILDNVDEKNAGDYQCLADDGSR 243

  Fly   363 QPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLH 397
            .|....|||....:|....|.|...:.|...::|:
  Fly   244 HPPHGTVHIDVQYSPIVSTHRHNVNTEKGATAELY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 8/37 (22%)
IG_like 182..262 CDD:214653 4/23 (17%)
IG_like 285..362 CDD:214653 13/81 (16%)
IGc2 292..361 CDD:197706 13/73 (18%)
CG13506NP_001286718.1 IG_like 79..146 CDD:214653 3/16 (19%)
IGc2 83..146 CDD:197706 3/16 (19%)
IG_like 176..254 CDD:214653 17/92 (18%)
Ig 176..239 CDD:299845 12/77 (16%)
I-set 258..349 CDD:254352 5/21 (24%)
Ig 275..348 CDD:143165 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.