DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Sdk2

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_006247755.1 Gene:Sdk2 / 360652 RGDID:1310397 Length:2175 Species:Rattus norvegicus


Alignment Length:435 Identity:86/435 - (19%)
Similarity:149/435 - (34%) Gaps:115/435 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 SGLYR--IKN--GRVLDRLQKPAALIFIIAYIAACGICDHTASASPGGGKTVAATMTT------- 58
            :|.||  ::|  |.:|.|..:..     :||:.:....:...|.|.|....:.|...:       
  Rat    89 AGFYRCIVRNRMGALLQRQTEVQ-----VAYMGSFEEGEKHQSVSHGEAAVIKAPRISSFPRPQV 148

  Fly    59 ----------PASEPSVRHINQNLIMS--------------QSKEGEPVPVPQPYAQSAASAGGS 99
                      |:|..::...|..:|:|              ..|.|:. ...||...:..:.||.
  Rat   149 TWFRDGRKIPPSSRIAITLENTLVILSTVAPDAGRYYVQAVNDKNGDN-KTSQPITLAVENVGGP 212

  Fly   100 S-------ITSFDSTNVIDGQSQPTPTHLQEA--VLQTHSHSRIQAKDTA------GPYPIPVHR 149
            :       |....:|:|:.|.|:.|...:..|  :::.|.   :..||.|      ..|    :|
  Rat   213 ADPIAPTIIIPPKNTSVVAGTSEVTMECVANARPLIKLHI---VWKKDGALLSNGISDY----NR 270

  Fly   150 PEPVENHLEANNG----------------IEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCT 198
            ...:.|.:.::.|                ..|...|:...|. |..|....:|.::.....:||.
  Rat   271 RLTITNPMVSDAGYYECEAMLRSSSVAPVTRGAYLSVLEPPQ-FVREPERHITAEMEKVVDIPCR 334

  Fly   199 VHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYEC---- 259
            ...:....::|.  ||..|:.||          ..|..|...|..|||..:...|.|:.:|    
  Rat   335 AKGVPPPSITWY--KDAALVEVG----------KLTRFKQRSDGGLQISGLLPDDTGMVQCFAHN 387

  Fly   260 -----QVSTHPPTSIFLHLSVVEARAEIT-GPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDN 318
                 |.||        :|:|......|| ||....:..|.::.|.|..  :......|.|....
  Rat   388 AAGEAQTST--------YLAVTSIAPNITRGPLDSTVIDGMSVVLACET--SGAPRPAITWQKGE 442

  Fly   319 RMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQ 363
            |::   ....:.:......:|..|.|..|....:|.:||:|:|::
  Rat   443 RIL---ASGSVQLPRFTLLESGSLLISPTHISDAGTYTCLATNSR 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 23/104 (22%)
IG_like 182..262 CDD:214653 19/88 (22%)
IG_like 285..362 CDD:214653 15/76 (20%)
IGc2 292..361 CDD:197706 14/68 (21%)
Sdk2XP_006247755.1 IG_like 43..112 CDD:214653 7/27 (26%)
IGc2 43..101 CDD:197706 4/11 (36%)
IG_like 123..206 CDD:214653 13/83 (16%)
Ig 135..191 CDD:299845 6/55 (11%)
IG_like 225..307 CDD:214653 15/88 (17%)
IGc2 236..289 CDD:197706 10/59 (17%)
I-set 311..400 CDD:254352 25/109 (23%)
Ig 329..397 CDD:143165 20/87 (23%)
I-set 405..495 CDD:254352 19/85 (22%)
Ig 419..495 CDD:299845 15/71 (21%)
Ig 505..589 CDD:299845
IG_like 505..589 CDD:214653
FN3 593..684 CDD:238020
FN3 696..789 CDD:238020
FN3 797..893 CDD:238020
FN3 898..986 CDD:238020
FN3 996..1090 CDD:238020
FN3 1102..1197 CDD:238020
FN3 1204..1293 CDD:238020
FN3 1304..1397 CDD:238020
FN3 1403..1487 CDD:238020
FN3 1506..1619 CDD:238020
FN3 1629..1722 CDD:238020
FN3 1727..1808 CDD:238020
FN3 1840..1919 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.