DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Dscam1

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001246162.1 Gene:Dscam1 / 35652 FlyBaseID:FBgn0033159 Length:2038 Species:Drosophila melanogaster


Alignment Length:312 Identity:72/312 - (23%)
Similarity:115/312 - (36%) Gaps:74/312 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 IMSQSKEGE-PVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQA 136
            :..|.::|: |:.|...:.:||...|      ||       |.||.        ::|   :||..
  Fly   641 LFCQIQKGDRPIKVHWSFERSAGDYG------FD-------QVQPQ--------MRT---NRISE 681

  Fly   137 KDT--AGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQI---------- 189
            |.:  :.|...|.|...  :..:.:|..         ||..|     |..:|..:          
  Fly   682 KTSMISIPSASPAHTGR--DTCIASNKA---------GTTTY-----SVDLTVNVPPRWILEPTD 730

  Fly   190 -----GATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249
                 |:.|.|.|......:..|:|  ||     .||.|.....:...:.::: .|:.||.:..:
  Fly   731 KAFAQGSDAKVECKADGFPKPQVTW--KK-----AVGDTPGEYKDLKKSDNIR-VEEGTLHVDNI 787

  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSV-VEARAEITGPPIRYLTP--GSTLRLQCRVVQNTEASEY 311
            |..:.|.|.|:......:.:...:.: |:|..|.| ..:|..|.  |....|||..  ..|....
  Fly   788 QKTNEGYYLCEAINGIGSGLSAVIMISVQAPPEFT-EKLRNQTARRGEPAVLQCEA--KGEKPIG 849

  Fly   312 IFWYHDNRMINYDIDRGINVSTE--PDFQSSELTIQRTRREHSGNFTCVASN 361
            |.|..:|..::...|....:..|  .....|.|:|:||.|..|..|||||:|
  Fly   850 ILWNMNNMRLDPKNDNRYTIREEILSTGVMSSLSIKRTERSDSALFTCVATN 901

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 20/111 (18%)
IG_like 182..262 CDD:214653 20/94 (21%)
IG_like 285..362 CDD:214653 25/81 (31%)
IGc2 292..361 CDD:197706 22/72 (31%)
Dscam1NP_001246162.1 Ig 38..130 CDD:299845
IG 57..133 CDD:214652
IG_like 267..343 CDD:214653
Ig 269..340 CDD:143165
IG_like 353..425 CDD:214653
IGc2 361..413 CDD:197706
I-set 433..527 CDD:254352
IGc2 446..517 CDD:197706
I-set 533..618 CDD:254352
IGc2 544..607 CDD:197706
Ig 641..714 CDD:143165 23/112 (21%)
IGc2 735..804 CDD:197706 18/76 (24%)
I-set 819..914 CDD:254352 27/86 (31%)
Ig 833..921 CDD:299845 23/71 (32%)
FN3 918..1011 CDD:238020
FN3 1018..1116 CDD:238020
FN3 1124..1217 CDD:238020
FN3 1222..1312 CDD:238020
Ig 1339..1406 CDD:299845
FN3 1409..1499 CDD:238020
FN3 1504..1584 CDD:238020
Dscam_C 1890..2008 CDD:289151
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.