DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and DIP-iota

DIOPT Version :10

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:96/225 - (42%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGL 222
            |.||          ..|.:.|..|::  |..:|..|.:.|.||.:....|:|:|.....:|::..
  Fly    25 ELNN----------SDPKFSGPINNS--TVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQN 77

  Fly   223 TTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPP- 286
            ...:.:.|.|.:|.:| ..|.|:|:.||..|.|.|.||::|.|..|...:|.||.       || 
  Fly    78 HVITKNHRISISHTEH-RIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVV-------PPD 134

  Fly   287 -IRYLT-------PGSTLRLQCR---VVQNTEASEYIFWYHDNR---MINYDIDRGINVSTEPDF 337
             :.|.|       .|..:.|.|.   |...|     |.|..:..   :|:.|.||.: .|.|   
  Fly   135 IVDYQTSQDVVRSTGQNVTLTCSATGVPMPT-----ITWRREEATPILISDDGDREV-FSVE--- 190

  Fly   338 QSSELTIQRTRREHSGNFTCVASNTQPASV 367
             ...||:.:.:|.|.|.:.|:|||..|.:|
  Fly   191 -GQNLTLWQVQRSHMGAYLCIASNGVPPTV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:462230 29/95 (31%)
Ig_3 281..361 CDD:464046 24/94 (26%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/88 (31%)
Ig strand B 48..52 CDD:143290 1/3 (33%)
Ig strand C 61..65 CDD:143290 1/3 (33%)
Ig strand E 96..100 CDD:143290 2/3 (67%)
Ig strand F 110..115 CDD:143290 2/4 (50%)
Ig 133..227 CDD:472250 27/97 (28%)
Ig strand B 152..156 CDD:409562 1/3 (33%)
Ig strand C 165..169 CDD:409562 2/8 (25%)
Ig strand E 192..196 CDD:409562 1/3 (33%)
Ig strand F 206..211 CDD:409562 1/4 (25%)
Ig strand G 220..223 CDD:409562 64/225 (28%)
Ig_3 231..310 CDD:464046
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.