DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and DIP-iota

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001097100.1 Gene:DIP-iota / 33925 FlyBaseID:FBgn0031837 Length:376 Species:Drosophila melanogaster


Alignment Length:225 Identity:64/225 - (28%)
Similarity:96/225 - (42%) Gaps:45/225 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   158 EANNGIEGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGL 222
            |.||          ..|.:.|..|::  |..:|..|.:.|.||.:....|:|:|.....:|::..
  Fly    25 ELNN----------SDPKFSGPINNS--TVPVGRDALLTCVVHDLVSFKVAWLRVDTQTILSIQN 77

  Fly   223 TTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPP- 286
            ...:.:.|.|.:|.:| ..|.|:|:.||..|.|.|.||::|.|..|...:|.||.       || 
  Fly    78 HVITKNHRISISHTEH-RIWQLKIRDVQESDRGWYMCQINTDPMKSQMGYLDVVV-------PPD 134

  Fly   287 -IRYLT-------PGSTLRLQCR---VVQNTEASEYIFWYHDNR---MINYDIDRGINVSTEPDF 337
             :.|.|       .|..:.|.|.   |...|     |.|..:..   :|:.|.||.: .|.|   
  Fly   135 IVDYQTSQDVVRSTGQNVTLTCSATGVPMPT-----ITWRREEATPILISDDGDREV-FSVE--- 190

  Fly   338 QSSELTIQRTRREHSGNFTCVASNTQPASV 367
             ...||:.:.:|.|.|.:.|:|||..|.:|
  Fly   191 -GQNLTLWQVQRSHMGAYLCIASNGVPPTV 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 29/95 (31%)
IG_like 182..262 CDD:214653 24/79 (30%)
IG_like 285..362 CDD:214653 25/91 (27%)
IGc2 292..361 CDD:197706 20/74 (27%)
DIP-iotaNP_001097100.1 IG_like 39..125 CDD:214653 27/88 (31%)
Ig 39..122 CDD:299845 26/85 (31%)
Ig 132..213 CDD:299845 24/90 (27%)
IG_like 141..227 CDD:214653 24/89 (27%)
IG_like 239..322 CDD:214653
IGc2 245..313 CDD:197706
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.