Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001188701.2 | Gene: | DIP-eta / 33793 | FlyBaseID: | FBgn0031725 | Length: | 450 | Species: | Drosophila melanogaster |
Alignment Length: | 201 | Identity: | 56/201 - (27%) |
---|---|---|---|
Similarity: | 94/201 - (46%) | Gaps: | 29/201 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249
Fly 250 QLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPP--IRYLT-------PGSTLRLQCRVVQN 305
Fly 306 TEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASV--- 367
Fly 368 ---LVH 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 26/90 (29%) |
IG_like | 182..262 | CDD:214653 | 22/76 (29%) | ||
IG_like | 285..362 | CDD:214653 | 22/85 (26%) | ||
IGc2 | 292..361 | CDD:197706 | 17/68 (25%) | ||
DIP-eta | NP_001188701.2 | Ig | 51..141 | CDD:299845 | 26/89 (29%) |
IG_like | 51..137 | CDD:214653 | 25/85 (29%) | ||
IG_like | 153..237 | CDD:214653 | 22/89 (25%) | ||
Ig | 161..224 | CDD:299845 | 18/68 (26%) | ||
IG_like | 252..335 | CDD:214653 | |||
Ig | 258..333 | CDD:143165 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 46 | 1.000 | Domainoid score | I11916 |
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |