DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and bdl

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:434 Identity:96/434 - (22%)
Similarity:139/434 - (32%) Gaps:126/434 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MPASSGLYRIKNGRVLDRLQKPAALIFIIAYIAACGI-CDHTASASPGGGKTVAATMTTPASEPS 64
            |||       |..|..  .|..:||:.::|.|....| |                   |.|:...
  Fly     1 MPA-------KRSRTF--RQSGSALLALLAIILLMNISC-------------------TSAARDH 37

  Fly    65 VRHINQNLIMSQSKEGE----------PVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPT 119
            .|..|     .::|.|.          |...|.||......         |:..:.....|.|.|
  Fly    38 RRQTN-----LEAKVGSHVVFNCYIDFPFDAPIPYLVHWTK---------DNKKIFTWYEQETST 88

  Fly   120 --------HLQEAVLQTH-SHSRIQAKDTA------GPYPIPVHRPEPVENHLEANNG------I 163
                    ||    ::.| ...|.....||      |.|...|..|.  .:....|||      :
  Fly    89 SELFNGRLHL----VENHPEFGRASVNLTAIRESDQGWYHCQVSFPN--RSPSVRNNGTAYHLAV 147

  Fly   164 EGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSD 228
            :||  ||...|    ..|.|:   :.|.||...|.:.|......||.  ||..||        .:
  Fly   148 QGG--SLIRIP----PVNQTI---REGQTAFFHCVMKHPENSQASWY--KDGVLL--------QE 193

  Fly   229 ERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTH----PPTSIFLHLSVVEARAE-ITGPPIR 288
            .:..........|.:|.|....:.|.|.|||:|...    .....||:   ::.:|: |..||..
  Fly   194 VQDLVRRFYMGPDGSLSIDPTMMSDLGEYECKVRNSDGELQTAKAFLN---IQYKAKVIYAPPEV 255

  Fly   289 YLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI-NYDIDRGINVSTEPDFQSSELTIQRTRREHS 352
            :|..|....|.|....|..... :.|..|..:. :|::. |:...     .:..|...:....|:
  Fly   256 FLPYGQPAVLDCHFRANPPLKN-LRWEKDGLLFDSYNVP-GVFYK-----MNGSLFFAKVDENHA 313

  Fly   353 GNFTCVASN-------TQPASVLV---HIFKGDNPAAMYHGHVG 386
            |::||...|       :...||:|   .|| ...|.|:|...:|
  Fly   314 GSYTCTPYNDLGTDGPSPVISVIVLRPPIF-SVTPKAIYIQKLG 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 24/99 (24%)
IG_like 182..262 CDD:214653 20/79 (25%)
IG_like 285..362 CDD:214653 17/84 (20%)
IGc2 292..361 CDD:197706 13/69 (19%)
bdlNP_608822.1 IG_like 42..128 CDD:214653 19/103 (18%)
Ig 43..131 CDD:299845 19/100 (19%)
I-set 153..242 CDD:254352 25/108 (23%)
Ig 157..242 CDD:299845 24/100 (24%)
Ig_2 252..337 CDD:290606 19/91 (21%)
IG_like 260..327 CDD:214653 14/73 (19%)
I-set 341..428 CDD:254352 6/17 (35%)
IGc2 356..419 CDD:197706 1/1 (100%)
FN3 435..524 CDD:238020
FN3 554..636 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.