DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and DIP-beta

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:236 Identity:66/236 - (27%)
Similarity:100/236 - (42%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LEANNGIE--GGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIG-----------EGVVS 208
            |..:|.|.  |..|..|..|:    ||.|:..   |..|...|.|:::|           ...|:
  Fly    84 LTVSNKISSVGAFEPDFVIPL----ENVTIAQ---GRDATFTCVVNNLGGHRVSGDGSSAPAKVA 141

  Fly   209 WIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHL 273
            ||:.....:|.:.....::::|.|..|..:: .|||.|:.|::.|||.|.|||:|.|       :
  Fly   142 WIKADAKAILAIHEHVITNNDRLSVQHNDYN-TWTLNIRGVKMEDAGKYMCQVNTDP-------M 198

  Fly   274 SVVEARAEITGPP--IRYLTPGSTL-------RLQCRVVQNTEASEYIFW-YHDNRMINYDIDR- 327
            .:..|..|:..||  |...|.|..:       :|.||...:.:..  |.| ..|.|.|   |.| 
  Fly   199 KMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPK--ITWRREDGREI---IARN 258

  Fly   328 GINVSTEPDFQSSE-LTIQRTRREHSGNFTCVASNTQPASV 367
            |.:..|:......| ||:.:..|...|.:.|:|||..|.:|
  Fly   259 GSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 29/106 (27%)
IG_like 182..262 CDD:214653 24/90 (27%)
IG_like 285..362 CDD:214653 25/88 (28%)
IGc2 292..361 CDD:197706 20/78 (26%)
DIP-betaNP_001138225.1 I-set 98..209 CDD:254352 33/125 (26%)
ig 102..195 CDD:278476 28/100 (28%)
IG_like 219..307 CDD:214653 24/86 (28%)
Ig 221..307 CDD:299845 23/84 (27%)
Ig 311..404 CDD:299845
IG_like 327..405 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 46 1.000 Domainoid score I11916
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.