DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and DIP-beta

DIOPT Version :10

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001138225.1 Gene:DIP-beta / 33125 FlyBaseID:FBgn0259245 Length:555 Species:Drosophila melanogaster


Alignment Length:236 Identity:66/236 - (27%)
Similarity:100/236 - (42%) Gaps:45/236 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 LEANNGIE--GGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIG-----------EGVVS 208
            |..:|.|.  |..|..|..|:    ||.|:..   |..|...|.|:::|           ...|:
  Fly    84 LTVSNKISSVGAFEPDFVIPL----ENVTIAQ---GRDATFTCVVNNLGGHRVSGDGSSAPAKVA 141

  Fly   209 WIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHL 273
            ||:.....:|.:.....::::|.|..|..:: .|||.|:.|::.|||.|.|||:|.|       :
  Fly   142 WIKADAKAILAIHEHVITNNDRLSVQHNDYN-TWTLNIRGVKMEDAGKYMCQVNTDP-------M 198

  Fly   274 SVVEARAEITGPP--IRYLTPGSTL-------RLQCRVVQNTEASEYIFW-YHDNRMINYDIDR- 327
            .:..|..|:..||  |...|.|..:       :|.||...:.:..  |.| ..|.|.|   |.| 
  Fly   199 KMQTATLEVVIPPDIINEETSGDMMVPEGGSAKLVCRARGHPKPK--ITWRREDGREI---IARN 258

  Fly   328 GINVSTEPDFQSSE-LTIQRTRREHSGNFTCVASNTQPASV 367
            |.:..|:......| ||:.:..|...|.:.|:|||..|.:|
  Fly   259 GSHQKTKAQSVEGEMLTLSKITRSEMGAYMCIASNGVPPTV 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:462230 29/106 (27%)
Ig_3 281..361 CDD:464046 25/91 (27%)
DIP-betaNP_001138225.1 Ig 98..209 CDD:472250 33/125 (26%)
Ig strand B 115..119 CDD:409353 1/3 (33%)
Ig strand C 139..143 CDD:409353 1/3 (33%)
Ig strand E 174..178 CDD:409353 3/3 (100%)
Ig strand F 188..193 CDD:409353 2/4 (50%)
Ig strand G 202..205 CDD:409353 1/2 (50%)
Ig 211..307 CDD:472250 27/94 (29%)
Ig strand B 230..234 CDD:409353 1/3 (33%)
Ig strand C 243..247 CDD:409353 1/5 (20%)
Ig strand E 272..276 CDD:409353 2/3 (67%)
Ig strand F 286..291 CDD:409353 1/4 (25%)
Ig strand G 300..303 CDD:409353 66/236 (28%)
IG_like 327..405 CDD:214653
Ig strand B 328..332 CDD:409353
Ig strand C 341..346 CDD:409353
Ig strand E 365..376 CDD:409353
Ig strand F 386..391 CDD:409353
Ig strand G 399..402 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.