DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and dpr8

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001285239.1 Gene:dpr8 / 32387 FlyBaseID:FBgn0052600 Length:344 Species:Drosophila melanogaster


Alignment Length:231 Identity:95/231 - (41%)
Similarity:140/231 - (60%) Gaps:2/231 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 FGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSED 241
            |.|...|.:|..:|.|..:.|.|.::|...|||:|.:|.||||||..||:||:||.|.|..|:||
  Fly    44 FDTTIGTNITGLVGKTVKLTCRVKNLGNRTVSWVRHRDIHLLTVGRYTYTSDQRFEAMHSPHAED 108

  Fly   242 WTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPGSTLRLQCRVVQNT 306
            |||:|::.|.:|:|:||||:||.||....::|::||...:|.|.|..::..|||:.|.|.|....
  Fly   109 WTLRIRYAQRKDSGIYECQISTTPPIGHSVYLNIVEPVTDIIGGPELHINRGSTINLTCIVKFAP 173

  Fly   307 EASEYIFWYHDNRMINYDIDR-GINVSTEPD-FQSSELTIQRTRREHSGNFTCVASNTQPASVLV 369
            |....:.|.|:..:||:|..| ||::.||.. ..:|.|.:|:...:.||.:||..||..|.||.|
  Fly   174 EPPPTVIWSHNREIINFDSPRGGISLVTEKGVLTTSRLLVQKAITQDSGLYTCTPSNANPTSVRV 238

  Fly   370 HIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIAS 405
            ||..|::||||:.|:.|.||.:....|..::::..|
  Fly   239 HIVDGEHPAAMHTGNNGNSTASQPPVLLPLVLLTCS 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 45/95 (47%)
IG_like 182..262 CDD:214653 40/79 (51%)
IG_like 285..362 CDD:214653 26/78 (33%)
IGc2 292..361 CDD:197706 24/70 (34%)
dpr8NP_001285239.1 IG_like 51..131 CDD:214653 40/79 (51%)
V-set 52..143 CDD:284989 44/90 (49%)
IG_like 153..238 CDD:214653 30/84 (36%)
ig 153..232 CDD:278476 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D60798at7147
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
87.970

Return to query results.
Submit another query.