DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and dpr14

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001245573.1 Gene:dpr14 / 31702 FlyBaseID:FBgn0029974 Length:340 Species:Drosophila melanogaster


Alignment Length:353 Identity:101/353 - (28%)
Similarity:162/353 - (45%) Gaps:72/353 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 SVRHI---NQNLIMSQSKEGEPVPV-PQPYAQSAASAGGSSITSFDSTNVIDGQSQPTPTHLQEA 124
            |:.||   :.:..:.:.:.|:|... |:.:.|..:|                 ....||...:..
  Fly    15 SLHHIGSGSTSTTLKRPRAGDPFDTFPKNFWQEFSS-----------------PFTDTPEDEELE 62

  Fly   125 VLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQI 189
            |.:|.:|.         |:|                         .|..|  :.|.|   ::||:
  Fly    63 VTETTTHE---------PFP-------------------------FFADP--YTTLN---ISTQL 88

  Fly   190 GATAHVPCTVHHIGEGVVSWIRKK--DYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLR 252
            .::.::.|.|:.:....|||:|::  |..|:|.|..|||.|.|:| ...:...||.|.|:|...|
  Fly    89 SSSVYLHCRVNDLQGKTVSWMRRRGDDLTLITFGQHTYSGDSRYS-LEFEEPNDWKLLIQFANER 152

  Fly   253 DAGVYECQVSTHPPTSIFLHLSVVEARAEI-----TGPPIRYLTPGSTLRLQCRVVQNTEASEYI 312
            |.|.||||||:|||..:.::|:::....||     :..|.:|...|||:.|||.:.:....|.||
  Fly   153 DEGPYECQVSSHPPLVLLVYLTIIVPHVEILDERGSATPEKYYKAGSTIELQCVISKIPHPSSYI 217

  Fly   313 FWYHDNRMINYDIDR-GINVSTE--PDFQSSELTIQRTRREHSGNFTCVASNTQPASVLVHIFKG 374
            .|.|..|::|||..| ||:|.|:  |....|.|.|....|:.:||:||:..|....:|:||:..|
  Fly   218 TWRHGPRLLNYDTSRGGISVKTDMLPGRALSRLYIANANRQDTGNYTCMLGNEITETVVVHVLNG 282

  Fly   375 DNPAAMYHGHVGGSTKTTQSQLHMIMII 402
            :.||||.|.: |...|...|.:.::.::
  Fly   283 EEPAAMQHAN-GSRQKANASTMVVLFLV 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 37/97 (38%)
IG_like 182..262 CDD:214653 30/81 (37%)
IG_like 285..362 CDD:214653 31/79 (39%)
IGc2 292..361 CDD:197706 29/71 (41%)
dpr14NP_001245573.1 IG_like 83..163 CDD:214653 32/83 (39%)
Ig 84..169 CDD:299845 35/85 (41%)
IG_like 191..279 CDD:214653 34/87 (39%)
Ig 201..274 CDD:143165 27/72 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
76.960

Return to query results.
Submit another query.