| Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038938277.1 | Gene: | Jaml / 315610 | RGDID: | 1562572 | Length: | 379 | Species: | Rattus norvegicus |
| Alignment Length: | 277 | Identity: | 54/277 - (19%) |
|---|---|---|---|
| Similarity: | 101/277 - (36%) | Gaps: | 70/277 - (25%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 179 TENSTVVTTQIGATAHVPCTVHHIGE---GVVSWIRKKDYHL-----------LTVGLTTYSSDE 229
Fly 230 RFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSI---FLHLSVV-----EARAEITGPP 286
Fly 287 I------RYLTPGSTLRLQCRVVQNTEASEYIFWYHD---------------NRM-INYDIDRGI 329
Fly 330 NVSTEPDFQSSELTIQRTRREHSGNFTC---VASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKT 391
Fly 392 TQSQL-----HMIMIII 403 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 25/112 (22%) |
| IG_like | 182..262 | CDD:214653 | 22/93 (24%) | ||
| IG_like | 285..362 | CDD:214653 | 17/101 (17%) | ||
| IGc2 | 292..361 | CDD:197706 | 14/87 (16%) | ||
| Jaml | XP_038938277.1 | V-set | 33..139 | CDD:400157 | 24/107 (22%) |
| FR2 | 58..69 | CDD:409353 | 4/10 (40%) | ||
| CDR2 | 70..82 | CDD:409353 | 1/11 (9%) | ||
| Ig strand C' | 71..77 | CDD:409353 | 0/5 (0%) | ||
| Ig strand C' | 78..82 | CDD:409353 | 1/3 (33%) | ||
| FR3 | 87..121 | CDD:409353 | 10/35 (29%) | ||
| Ig strand D | 90..96 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 100..108 | CDD:409353 | 2/9 (22%) | ||
| Ig strand F | 115..122 | CDD:409353 | 3/6 (50%) | ||
| V-set | 141..253 | CDD:400157 | 20/122 (16%) | ||
| Ig strand A' | 144..150 | CDD:409353 | 2/5 (40%) | ||
| Ig strand B | 152..162 | CDD:409353 | 2/9 (22%) | ||
| CDR1 | 162..169 | CDD:409353 | 0/6 (0%) | ||
| Ig strand C | 169..176 | CDD:409353 | 1/6 (17%) | ||
| FR2 | 170..181 | CDD:409353 | 1/10 (10%) | ||
| CDR2 | 182..196 | CDD:409353 | 3/13 (23%) | ||
| Ig strand C' | 183..189 | CDD:409353 | 2/5 (40%) | ||
| Ig strand C' | 191..196 | CDD:409353 | 0/4 (0%) | ||
| FR3 | 204..238 | CDD:409353 | 9/43 (21%) | ||
| Ig strand D | 207..213 | CDD:409353 | 1/5 (20%) | ||
| Ig strand E | 217..225 | CDD:409353 | 0/7 (0%) | ||
| Ig strand F | 232..238 | CDD:409353 | 3/5 (60%) |
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 48 | 1.000 | Inparanoid score | I5388 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||