DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Kirrel3

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:XP_038937320.1 Gene:Kirrel3 / 315546 RGDID:1311382 Length:869 Species:Rattus norvegicus


Alignment Length:405 Identity:86/405 - (21%)
Similarity:150/405 - (37%) Gaps:121/405 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 PASSGLYRIKNGRVLD------------RLQKPAALIFIIAYIAACG---ICDHTASASPGGGKT 51
            ||:|.:: ::.|.|::            :.:...:.:||.......|   :|..|..|.|||.:|
  Rat   177 PAASIIW-LRKGEVINGATYSKTLLRDGKRESIVSTLFISPGDVENGQSIVCRATNKAIPGGKET 240

  Fly    52 VAATMTTPASEPSVRHINQNLIMSQSKEGEPVPVPQPYAQSAASAGGSSITSFDSTNVIDGQSQP 116
               ::|.....|.:  :|.::        ||.||.:           .:|.:|..:    .::.|
  Rat   241 ---SVTIDIQHPPL--VNLSV--------EPQPVLE-----------DNIVTFHCS----AKANP 277

  Fly   117 TPTHLQEAVLQTHSHSRIQAKDTAGP-YPIPV---HRPEPVENHLEANNGIEGGMESLFGT-PMY 176
            ..|..:.|   ...|.   .|:.:|. |...|   :..|||.  .|..|.:  |..:|..| .:|
  Rat   278 AVTQYRWA---KRGHI---IKEASGELYRTTVDYTYFSEPVS--CEVTNAL--GSTNLSRTVDVY 332

  Fly   177 FG---TENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKH 238
            ||   |.....:...:|:.|...|          :||......::.:        :|.|...|  
  Rat   333 FGPRMTSEPQSLLVDLGSDAVFSC----------AWIGNPSLTIVWM--------KRGSGVVL-- 377

  Fly   239 SEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVV--------EARAEITGPPI------RY 289
            |.:.||.:|.|:..|||.|.|:             :||        |....:.||||      ::
  Rat   378 SNEKTLTLKSVRQEDAGKYVCR-------------AVVPRVGAGEREVTLTVNGPPIISSTQTQH 429

  Fly   290 LTPGSTLRLQCRVVQNTEASEYIFWYHDNRMI------NYDIDRGINVSTEPDFQSSELTIQR-T 347
            ...|...:::| .:::|...:.|.|.....::      .|.::   .|:||....|: |||.. .
  Rat   430 ALHGEKGQIKC-FIRSTPPPDRIAWSWKENVLESGTSGRYTVE---TVNTEEGVIST-LTISNIV 489

  Fly   348 RREHSGNFTCVASNT 362
            |.:....:.|.|.|:
  Rat   490 RADFQTIYNCTAWNS 504

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 18/95 (19%)
IG_like 182..262 CDD:214653 18/79 (23%)
IG_like 285..362 CDD:214653 19/89 (21%)
IGc2 292..361 CDD:197706 16/75 (21%)
Kirrel3XP_038937320.1 IG_like 54..143 CDD:214653
Ig strand A' 56..60 CDD:409353
Ig strand B 64..71 CDD:409353
Ig strand C 78..82 CDD:409353
Ig strand C' 84..87 CDD:409353
Ig strand D 97..101 CDD:409353
Ig strand E 104..116 CDD:409353
Ig strand G 132..143 CDD:409353
IgI_2_KIRREL3-like 149..246 CDD:409416 16/72 (22%)
Ig strand B 166..170 CDD:409416
Ig strand C 180..184 CDD:409416 1/4 (25%)
Ig strand E 210..214 CDD:409416 0/3 (0%)
Ig strand F 224..229 CDD:409416 1/4 (25%)
Ig strand G 239..242 CDD:409416 1/5 (20%)
Ig <267..334 CDD:416386 18/80 (23%)
Ig strand B 267..274 CDD:409353 1/10 (10%)
Ig strand C 279..286 CDD:409353 2/9 (22%)
Ig strand C' 288..291 CDD:409353 1/5 (20%)
Ig strand D 298..302 CDD:409353 1/3 (33%)
Ig strand E 304..310 CDD:409353 0/5 (0%)
Ig strand G 321..334 CDD:409353 4/12 (33%)
Ig 335..416 CDD:416386 22/113 (19%)
Ig strand A' 343..347 CDD:409353 0/3 (0%)
Ig strand B 350..360 CDD:409353 3/19 (16%)
Ig strand C 365..371 CDD:409353 0/13 (0%)
Ig strand E 381..387 CDD:409353 2/5 (40%)
IgI_5_KIRREL3 418..515 CDD:409479 21/92 (23%)
Ig strand B 436..440 CDD:409479 0/3 (0%)
Ig strand C 450..454 CDD:409479 1/3 (33%)
Ig strand E 481..485 CDD:409479 2/4 (50%)
Ig strand F 496..501 CDD:409479 1/4 (25%)
Ig strand G 509..512 CDD:409479
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.