DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Fas2

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001284854.1 Gene:Fas2 / 31364 FlyBaseID:FBgn0000635 Length:885 Species:Drosophila melanogaster


Alignment Length:316 Identity:65/316 - (20%)
Similarity:108/316 - (34%) Gaps:108/316 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 THLQEAVLQTHSHSRIQAKDTAGPYPIPVHRPEPVENHLEA--------NNGIEGGMESLFGTPM 175
            |..|..:|:.:....:|.|....|. |...||...|..|.|        ||.|..........||
  Fly    26 TRAQSPILEIYPKQEVQRKPVGKPL-ILTCRPTVPEPSLVADLQWKDNRNNTILPKPNGRNQPPM 89

  Fly   176 YFGTEN---------STVVTTQIGATAHVPCTVHH-----IGEGV-------VSWIRKKDYHLLT 219
            |  ||.         .|.::.::|...:  ||..:     :.:||       ::|....:....|
  Fly    90 Y--TETLPGESLALMITSLSVEMGGKYY--CTASYANTEILEKGVTIKTYVAITWTNAPENQYPT 150

  Fly   220 VG-----LTTYSSDERFSATHLKH-------SEDWTLQ-----IKFVQLRDAGVYECQVSTHPPT 267
            :|     :....:|...:...|::       ::.:.:|     |:.||..|.|:|.|:.      
  Fly   151 LGQDYVVMCEVKADPNPTIDWLRNGDPIRTTNDKYVVQTNGLLIRNVQESDEGIYTCRA------ 209

  Fly   268 SIFLHLSVVEARAEITGPPIRYLTPGSTLR----LQCRVVQ---NTEASE--------------- 310
                  :|:|     ||..:.     .|:|    :|..::.   |.||.|               
  Fly   210 ------AVIE-----TGELLE-----RTIRVEVFIQPEIISLPTNLEAVEGKPFAANCTARGKPV 258

  Fly   311 -YIFWYHDNRMINYDIDRGINVSTEPDF----QSSELTIQRTRREHSGNFTCVASN 361
             .|.|..|...        :||:|...|    |:..:||....::..|.:||:|.|
  Fly   259 PEISWIRDATQ--------LNVATADRFQVNPQTGLVTISSVSQDDYGTYTCLAKN 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 20/133 (15%)
IG_like 182..262 CDD:214653 19/108 (18%)
IG_like 285..362 CDD:214653 22/104 (21%)
IGc2 292..361 CDD:197706 21/95 (22%)
Fas2NP_001284854.1 IG_like 39..133 CDD:214653 23/98 (23%)
IG_like 144..226 CDD:214653 18/103 (17%)
IGc2 152..209 CDD:197706 11/56 (20%)
I-set 230..319 CDD:254352 19/85 (22%)
IGc2 243..309 CDD:197706 16/72 (22%)
IG_like 330..424 CDD:214653
IGc2 339..412 CDD:197706
Ig 447..518 CDD:143165
fn3 534..611 CDD:278470
FN3 640..735 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.