DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and DIP-alpha

DIOPT Version :10

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_726871.1 Gene:DIP-alpha / 31322 FlyBaseID:FBgn0052791 Length:554 Species:Drosophila melanogaster


Alignment Length:271 Identity:70/271 - (25%)
Similarity:110/271 - (40%) Gaps:50/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 ENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTL 244
            |:.:.|:..:|..|...|.|.|:|...|.|::.....:..:.....:.:.|.:.:||..: .|.|
  Fly    46 ESISNVSVAVGRDATFTCHVRHLGGYRVGWLKADTKAIQAIHENVITHNPRVTVSHLDQN-TWNL 109

  Fly   245 QIKFVQLRDAGVYECQVSTHPPTSIFLHLSVV---EARAEITGPPIRYLTP-GSTLRLQCRVVQN 305
            .||.|...|.|.|.||::|.|..|....|.||   :..:|.|...:  :.| ||::||.||....
  Fly   110 HIKAVSEEDRGGYMCQLNTDPMKSQIGFLDVVIPPDFISEDTSSDV--IVPEGSSVRLTCRARGY 172

  Fly   306 TEASEYIFWYHD--NRMINYDIDRGINVSTE---PDFQSSELTIQRTRREHSGNFTCVASNTQPA 365
            .|  ..:.|..:  |.::..|     ||.|:   |.|:...|.:.:..|...|::.|:|||..|.
  Fly   173 PE--PIVTWRREDGNEIVLKD-----NVGTKTLAPSFRGEVLKLSKISRNEMGSYLCIASNGVPP 230

  Fly   366 SVLVHIFKGDNPAAMYHGH---------VGGSTKT-TQSQLHM---------------IMIIIAS 405
            ||...|      :...|.|         ||....| .|.:.|:               .||:.:.
  Fly   231 SVSKRI------SLSIHFHPVIQVPNQLVGAPLGTDVQIECHVEASPKSINYWIKDTGEMIVTSG 289

  Fly   406 GYRIFHTSVYM 416
            .|.:..:|..|
  Fly   290 KYHVQESSQSM 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:462230 27/95 (28%)
Ig_3 281..361 CDD:464046 23/85 (27%)
DIP-alphaNP_726871.1 IG_like 49..129 CDD:214653 22/80 (28%)
Ig strand B 59..63 CDD:409353 1/3 (33%)
Ig strand C 72..76 CDD:409353 1/3 (33%)
Ig strand E 103..111 CDD:409353 2/8 (25%)
Ig 152..240 CDD:472250 27/102 (26%)
Ig strand B 163..167 CDD:409275 2/3 (67%)
Ig strand C 176..180 CDD:409275 0/3 (0%)
Ig strand E 205..209 CDD:409275 1/3 (33%)
Ig strand F 219..224 CDD:409275 1/4 (25%)
Ig strand G 233..236 CDD:409275 0/2 (0%)
Ig 244..337 CDD:472250 10/57 (18%)
Ig strand B 261..265 CDD:409353 1/3 (33%)
Ig strand C 274..278 CDD:409353 0/3 (0%)
Ig strand E 305..309 CDD:409353
Ig strand F 319..324 CDD:409353
Ig strand G 332..335 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.