Sequence 1: | NP_001033956.2 | Gene: | dpr13 / 3885598 | FlyBaseID: | FBgn0034286 | Length: | 419 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_038944182.1 | Gene: | Lsamp / 29561 | RGDID: | 71102 | Length: | 378 | Species: | Rattus norvegicus |
Alignment Length: | 270 | Identity: | 61/270 - (22%) |
---|---|---|---|
Similarity: | 97/270 - (35%) | Gaps: | 98/270 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 178 GTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDW 242
Fly 243 TLQIKFVQLRDAGVYECQVST-HPPTSIFLHLSV--------------VEARAEIT------GPP 286
Fly 287 -----IRYLTP---------------GSTL----RLQCRVVQNTEASEY---------------- 311
Fly 312 ------------------------IFWYHDNRMINYDIDRGINV-STEPDFQSSELTIQRTRREH 351
Fly 352 SGNFTCVASN 361 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
dpr13 | NP_001033956.2 | V-set | 180..276 | CDD:284989 | 27/110 (25%) |
IG_like | 182..262 | CDD:214653 | 20/79 (25%) | ||
IG_like | 285..362 | CDD:214653 | 29/142 (20%) | ||
IGc2 | 292..361 | CDD:197706 | 24/128 (19%) | ||
Lsamp | XP_038944182.1 | Ig | 55..145 | CDD:416386 | 27/96 (28%) |
FR1 | 55..71 | CDD:409353 | 6/18 (33%) | ||
Ig strand A' | 56..62 | CDD:409353 | 2/8 (25%) | ||
Ig strand B | 64..72 | CDD:409353 | 3/7 (43%) | ||
CDR1 | 72..76 | CDD:409353 | 1/4 (25%) | ||
FR2 | 77..84 | CDD:409353 | 2/6 (33%) | ||
Ig strand C | 77..83 | CDD:409353 | 2/5 (40%) | ||
CDR2 | 85..95 | CDD:409353 | 1/11 (9%) | ||
Ig strand C' | 87..90 | CDD:409353 | 0/2 (0%) | ||
Ig strand C' | 92..95 | CDD:409353 | 0/2 (0%) | ||
FR3 | 96..131 | CDD:409353 | 11/35 (31%) | ||
Ig strand D | 100..107 | CDD:409353 | 1/7 (14%) | ||
Ig strand E | 110..116 | CDD:409353 | 1/5 (20%) | ||
Ig strand F | 123..131 | CDD:409353 | 3/7 (43%) | ||
CDR3 | 132..136 | CDD:409353 | 2/3 (67%) | ||
Ig strand G | 136..145 | CDD:409353 | 2/8 (25%) | ||
FR4 | 138..145 | CDD:409353 | 1/6 (17%) | ||
Ig_3 | 148..218 | CDD:404760 | 11/69 (16%) | ||
Ig strand A' | 155..160 | CDD:409353 | 0/4 (0%) | ||
Ig strand B | 166..173 | CDD:409353 | 1/6 (17%) | ||
Ig strand C | 179..184 | CDD:409353 | 0/4 (0%) | ||
Ig strand D | 190..193 | CDD:409353 | 0/2 (0%) | ||
Ig strand E | 197..203 | CDD:409353 | 0/5 (0%) | ||
Ig strand F | 210..217 | CDD:409353 | 1/6 (17%) | ||
Ig strand G | 224..232 | CDD:409353 | 0/7 (0%) | ||
Ig_3 | 235..311 | CDD:404760 | 20/80 (25%) | ||
Ig strand B | 252..256 | CDD:409353 | 0/3 (0%) | ||
Ig strand C | 265..269 | CDD:409353 | 0/3 (0%) | ||
Ig strand E | 290..294 | CDD:409353 | 2/3 (67%) | ||
Ig strand F | 304..309 | CDD:409353 | 3/4 (75%) | ||
Ig strand G | 318..321 | CDD:409353 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG3510 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |