DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and dpr7

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001096850.2 Gene:dpr7 / 2768865 FlyBaseID:FBgn0053481 Length:312 Species:Drosophila melanogaster


Alignment Length:254 Identity:88/254 - (34%)
Similarity:131/254 - (51%) Gaps:30/254 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VTTQIGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFV 249
            |:..:...|.:.|.|.:.|...|||:||:|.|:||..:.||:.|:|||..|...||||.|:|.:.
  Fly    61 VSAVVDEIAILRCRVKNKGNRTVSWMRKRDLHILTTNIYTYTGDQRFSVIHPPGSEDWDLKIDYA 125

  Fly   250 QLRDAGVYECQVSTHPPTSIFLHLSVV------------------EARAEITGPPIRYLTPGSTL 296
            |.||:|||||||:|.|..::.:.|.|:                  .|||:|.|....::...||:
  Fly   126 QPRDSGVYECQVNTEPKINL
AICLQVIADNDFQDLKTKKRFYDTKSARAKILGSTEIHVKRDSTI 190

  Fly   297 RLQCRVVQNTEASEYIFWYHDNRMINYDIDR-GINVSTEPD--FQSSELTIQRTRREHSGNFTCV 358
            .|.|.|  |..|.. :.|||.:.::::|..| ||::.||..  ..:|.|.:.|.....|||:|||
  Fly   191 ALACSV--NIHAPS-VIWYHGSSVVDFDSLRGGISLETEKTDVGTTSRLMLTRASLRDSGNYTCV 252

  Fly   359 ASNTQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGYRIFHTSVYMK 417
            .:...||||.||:..|:.||||.      ::...:.:....||.|.|...:.:.|..|:
  Fly   253 PNGAIPASVRVHVLTGEQPAAMQ------TSSAIRIRAFTAMITIISTKVLLYISSLME 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 40/90 (44%)
IG_like 182..262 CDD:214653 36/76 (47%)
IG_like 285..362 CDD:214653 25/79 (32%)
IGc2 292..361 CDD:197706 25/71 (35%)
dpr7NP_001096850.2 V-set 56..145 CDD:284989 39/83 (47%)
IG_like 58..140 CDD:214653 37/78 (47%)
IG_like 179..265 CDD:214653 30/88 (34%)
Ig 187..257 CDD:299845 25/72 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 42 1.000 Domainoid score I12424
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 82 1.000 Inparanoid score I3769
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000207
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23279
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X190
66.060

Return to query results.
Submit another query.