DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and NEGR1

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_776169.2 Gene:NEGR1 / 257194 HGNCID:17302 Length:354 Species:Homo sapiens


Alignment Length:318 Identity:68/318 - (21%)
Similarity:113/318 - (35%) Gaps:111/318 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 GATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDA 254
            |.||.:.|.:.. |....:|:.:..  ::..|...:|.|.|.|.:.| :..|::|||:.|.:.|.
Human    53 GDTAVLRCYLED-GASKGAWLNRSS--IIFAGGDKWSVDPRVSISTL-NKRDYSLQIQNVDVTDD 113

  Fly   255 GVYECQVST-HPPTSIFLHLSV--------------------VEARAEITGPP-----IRYLTPG 293
            |.|.|.|.| |.|.::.:||:|                    |......||.|     .|:::|.
Human   114 GPYTCSVQTQHTPRTMQVHLTV
QVPPKIYDISNDMTVNEGTNVTLTCLATGKPEPSISWRHISPS 178

  Fly   294 ST-----LRLQCRVVQNTEASEY------------------------------------------ 311
            :.     ..|....:...:|.||                                          
Human   179 AKPFENGQYLDIYGITRDQAGEYECSAENDVSFPDVRKVKVVVNFAPTIQEIKSGTVTPGRSGLI 243

  Fly   312 -----------IFWYHDNRMINYDIDRGI---NVSTEPDFQSSELTIQRTRREHSGNFTCVASN- 361
                       ..||...:.: ::..:||   |.||.     |.||:....:||.||:||||:| 
Human   244 RCEGAGVPPPAFEWYKGEKKL-FNGQQGIIIQNFSTR-----SILTVTNVTQEHFGNYTCVAANK 302

  Fly   362 --TQPASVLVHIFKGDNPAAMYHGHVGGSTKTTQSQLHMIMIIIASGYRIFHTSVYMK 417
              |..||:.:      ||.:.....:.||.....|..::::.:.:     |.:..|:|
Human   303 LGTTNASLPL------NPPSTAQYGITGSADVLFSCWYLVLTLSS-----FTSIFYLK 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 28/106 (26%)
IG_like 182..262 CDD:214653 21/71 (30%)
IG_like 285..362 CDD:214653 26/145 (18%)
IGc2 292..361 CDD:197706 23/129 (18%)
NEGR1NP_776169.2 IG 47..135 CDD:214652 27/85 (32%)
IGc2 152..210 CDD:197706 10/57 (18%)
Ig_3 225..301 CDD:372822 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.