DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Kirrel2

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_766486.1 Gene:Kirrel2 / 243911 MGIID:2442334 Length:700 Species:Mus musculus


Alignment Length:427 Identity:85/427 - (19%)
Similarity:125/427 - (29%) Gaps:139/427 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 ICDHTASASPGGGKTVAA------TMTTPASEPSVRHINQNLIMSQSKEGEPVP-VPQPYAQSAA 94
            ||...:.|.|.|..|...      .|.|.::||..           .:|||.|. :.|..||...
Mouse   200 ICRARSQALPTGRDTAVTLSLQYPPMVTLSAEPQT-----------VQEGEKVTFLCQATAQPPV 253

  Fly    95 SA-----GGSSITSFDSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIPVHRPEPVE 154
            :.     |||.:.         |...|....:.:|...|                      |||.
Mouse   254 TGYRWAKGGSPVL---------GARGPRLEVVADATFLT----------------------EPVS 287

  Fly   155 NHLEANNGI-----EGGMESLFGTPMYFGTENSTVVTTQIGATAHVPCTVHHIGEGVVSWIRKKD 214
              .|.:|.:     ...:|.|:| |:......|  |:..:|..|...|.........::|.|...
Mouse   288 --CEVSNAVGSANRSTALEVLYG-PILQAKPKS--VSVDVGKDASFSCVWRGNPLPRITWTRMGG 347

  Fly   215 YHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRDAGVYECQVSTHPPTSIFLHLSVVEAR 279
            ..:|:.|.                    ||::..|.|.|||.|.|:..   |....|.....:||
Mouse   348 SQVLSSGP--------------------TLRLPSVALEDAGDYVCRAE---PRRTGLGGGKAQAR 389

  Fly   280 AEITGPP-IRYLTPGSTL-----RLQCRVVQNTEASEYIFWYHDNRMI----------------- 321
            ..:..|| :..|.|....     |||| ||..:.|.:.:.|..|...:                 
Mouse   390 LTVNAPPVVTALQPAPAFLRGPARLQC-VVFASPAPDSVVWSWDEGFLEAGSLGRFLVEAFPAPE 453

  Fly   322 -------------------NYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASV 367
                               ..|...|.|.|.........:.|...||:.......||.....|:.
Mouse   454 VEGGQGPGLISVLHISGTQESDFTTGFNCSARNRLGEGRVQIHLGRRDLLPTVRIVAGAASAATS 518

  Fly   368 LVHIFKGDNPAAMYHG---------HVGGSTKTTQSQ 395
            |:.:..|.......||         .:.||::.:.|:
Mouse   519 LLMVITGVVLCCWRHGSLSKQKNLVRIPGSSEGSSSR 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 20/95 (21%)
IG_like 182..262 CDD:214653 18/79 (23%)
IG_like 285..362 CDD:214653 22/118 (19%)
IGc2 292..361 CDD:197706 19/109 (17%)
Kirrel2NP_766486.1 IG 27..116 CDD:214652
Ig 122..220 CDD:416386 6/19 (32%)
Ig strand A 123..126 CDD:409353
Ig strand A' 129..133 CDD:409353
Ig strand B 140..147 CDD:409353
Cell attachment site. /evidence=ECO:0000255 146..148
Ig strand C 153..158 CDD:409353
Ig strand C' 161..163 CDD:409353
Ig strand D 166..173 CDD:409353
Ig strand E 180..188 CDD:409353
Ig strand F 197..205 CDD:409353 2/4 (50%)
Ig strand G 211..217 CDD:409353 2/5 (40%)
Ig_3 223..292 CDD:404760 22/112 (20%)
Ig strand B 241..245 CDD:409353 1/3 (33%)
Ig strand C 255..259 CDD:409353 0/3 (0%)
Ig strand E 272..275 CDD:409353 0/2 (0%)
Ig strand F 281..290 CDD:409353 4/32 (13%)
Ig strand G 298..301 CDD:409353 0/2 (0%)
Ig 315..392 CDD:416386 22/101 (22%)
Ig strand A' 316..321 CDD:409353 2/6 (33%)
Ig strand B 324..333 CDD:409353 2/8 (25%)
Ig strand C 339..343 CDD:409353 0/3 (0%)
Ig strand C' 346..348 CDD:409353 0/1 (0%)
Ig strand D 351..354 CDD:409353 1/2 (50%)
Ig strand E 355..360 CDD:409353 2/24 (8%)
Ig strand F 368..376 CDD:409353 3/10 (30%)
Ig strand G 382..392 CDD:409353 2/9 (22%)
Ig 394..498 CDD:416386 18/104 (17%)
Ig strand A 395..399 CDD:409353 2/3 (67%)
Ig strand A' 401..404 CDD:409353 1/2 (50%)
Ig strand B 412..419 CDD:409353 5/7 (71%)
Ig strand C 426..431 CDD:409353 1/4 (25%)
Ig strand C' 433..436 CDD:409353 0/2 (0%)
Ig strand D 444..451 CDD:409353 0/6 (0%)
Ig strand E 461..468 CDD:409353 0/6 (0%)
Ig strand F 479..486 CDD:409353 3/6 (50%)
Ig strand G 489..496 CDD:409353 0/6 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 542..576 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 671..700
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.