DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Ptprq

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001357916.1 Gene:Ptprq / 237523 MGIID:1096349 Length:2301 Species:Mus musculus


Alignment Length:463 Identity:89/463 - (19%)
Similarity:152/463 - (32%) Gaps:143/463 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 KNGRVLDRLQKPAALIFIIAYIAACGICDHTASASPGGGKTVAATM------TTPASEPSVR--- 66
            :|....|.|:|....||.|           |.|...|..:|..|.:      ..|.:.|.:.   
Mouse  1109 ENSIYFDNLEKYTDYIFKI-----------TPSTEKGFSETYTAQLHIKTEEDVPDTPPIINTFK 1162

  Fly    67 -------------------------------HINQNLIMSQSKEGEPVPVPQ--PY--------A 90
                                           |.|:..:.|    |..:.:.:  |:        |
Mouse  1163 NLSSTSILLSWDPPLKPNGAILSYHLTLQGTHANRTFVTS----GNHIVLEELSPFTLYSFLAAA 1223

  Fly    91 QSAASAGGSSITSF---DSTNVIDGQSQPTPTHLQEAVLQTHSHSRIQAKDTAGPYPIP------ 146
            ::....|.|||..|   :|..:...|:.....:..:.|..|.|           |.|:|      
Mouse  1224 RTMKGLGPSSILFFYTDESAPLAPPQNLTLINYTSDFVWLTWS-----------PSPLPGGIVKV 1277

  Fly   147 ----VHRPEPVENHLEANNGIE-----GGME---------SLFGTPMYFGTENSTVV--TTQIG- 190
                :|..|......:..:|.:     .|:|         |.| |.:..|.:.|.||  |||.. 
Mouse  1278 YSFKIHEHETDTVFYKNISGFQTDAKLAGLEPVSTYSISVSAF-TKVGNGNQFSNVVKFTTQESV 1341

  Fly   191 --ATAHVPCTVHHIGEGVVSW--IRKKD----YHLLTV-GLTTYSS--DERFSATHLKHSEDWTL 244
              |..::.|.........|.|  .||.:    ::::|| |.:|..|  |..::.|.|..:..:..
Mouse  1342 PDAVQNIACVARDWQSVSVMWDPPRKANGIIIHYMITVEGNSTKVSPRDPMYTFTKLLANTSYIF 1406

  Fly   245 QIK-FVQLRDAGVYECQVSTHPPTSIFLHLSVVEARAEITGPPIRYLTPG------------STL 296
            ::: .....:....:|.|||.|.|...:..:...:..:.|...:|::.|.            :.|
Mouse  1407 EVRASTSAGEGNESQCNVSTLPETVPSVPTNTAFSNVQSTSVTLRWIKPDTILGYFQNYKITTQL 1471

  Fly   297 RLQ-CRVVQNTEASEY---IFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTC 357
            |.| ||..:..|..|:   .:.|..|:  ..|..||:.     .||.....:..:.....||.:.
Mouse  1472 RAQKCREWEPEECVEHQEVQYLYEANQ--TEDTVRGLK-----KFQWYRFQVAASTNAGYGNASS 1529

  Fly   358 -VASNTQP 364
             :::.|.|
Mouse  1530 WISTQTLP 1537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 26/110 (24%)
IG_like 182..262 CDD:214653 21/94 (22%)
IG_like 285..362 CDD:214653 18/93 (19%)
IGc2 292..361 CDD:197706 17/85 (20%)
PtprqNP_001357916.1 FN3 57..151 CDD:238020
FN3 308..393 CDD:238020
fn3 399..>441 CDD:365830
FN3 570..654 CDD:238020
fn3 668..744 CDD:365830
FN3 762..850 CDD:238020
fn3 857..934 CDD:365830
FN3 951..1049 CDD:238020
FN3 1056..1137 CDD:238020 10/38 (26%)
FN3 1152..1233 CDD:238020 9/84 (11%)
FN3 1247..1337 CDD:238020 19/101 (19%)
FN3 1342..1421 CDD:238020 14/78 (18%)
FN3 1432..1535 CDD:238020 19/109 (17%)
FN3 1542..1638 CDD:238020
FN3 1645..1734 CDD:238020
UP_III_II 1759..1928 CDD:297589
R-PTPc-Q 2033..2256 CDD:350464
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.