DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Ntm

DIOPT Version :10

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001344522.1 Gene:Ntm / 235106 MGIID:2446259 Length:367 Species:Mus musculus


Alignment Length:196 Identity:52/196 - (26%)
Similarity:87/196 - (44%) Gaps:40/196 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   185 VTTQIGATAHVPCTV-HHIGEGVVSWIRKKDYHLLTVGLTTYSSDER---FSATHLKHSEDWTLQ 245
            ||.:.|.:|.:.||: :.:..  |:|:.:..  :|..|...:..|.|   .|.|..::|    ::
Mouse    45 VTVRQGESATLRCTIDNRVTR--VAWLNRST--ILYAGNDKWCLDPRVVLLSNTQTQYS----IE 101

  Fly   246 IKFVQLRDAGVYECQVST--HPPTSIFLHL------SVVEARAEITGPPIRYLTPGSTLRLQCRV 302
            |:.|.:.|.|.|.|.|.|  ||.|| .:||      .:||..::|:      :..|:.:.|.|..
Mouse   102 IQNVDVYDEGPYTCSVQTDNHPKTS-RVHLIV
QVSPKIVEISSDIS------INEGNNISLTCIA 159

  Fly   303 VQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVASNTQPASV 367
            ....|.:  :.|.|.:       .:.:...:|.::    |.||...||.||.:.|.|||...|.|
Mouse   160 TGRPEPT--VTWRHIS-------PKAVGFVSEDEY----LEIQGITREQSGEYECSASNDVAAPV 211

  Fly   368 L 368
            :
Mouse   212 V 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:462230 29/102 (28%)
Ig_3 281..361 CDD:464046 17/79 (22%)
NtmNP_001344522.1 Ig 44..132 CDD:472250 29/95 (31%)
Ig strand B 53..57 CDD:409353 1/3 (33%)
Ig strand C 65..69 CDD:409353 1/5 (20%)
Ig strand E 98..102 CDD:409353 1/7 (14%)
Ig strand F 112..117 CDD:409353 2/4 (50%)
Ig strand G 125..128 CDD:409353 2/3 (67%)
Ig_3 136..205 CDD:464046 19/87 (22%)
Ig 223..307 CDD:472250
Ig strand B 239..243 CDD:409353
Ig strand C 252..256 CDD:409353
Ig strand E 278..282 CDD:409353
Ig strand F 292..297 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.