DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and IGSF9B

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001264214.1 Gene:IGSF9B / 22997 HGNCID:32326 Length:1437 Species:Homo sapiens


Alignment Length:369 Identity:68/369 - (18%)
Similarity:114/369 - (30%) Gaps:136/369 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 ASAGGSSITSFDSTNVIDGQSQP-------------------------TPTHLQEAVLQTHSHSR 133
            |.||.|.:...|..:.:.||..|                         .|.:...|.|...:..|
Human    35 ARAGESVVLRCDVIHPVTGQPPPYVVEWFKFGVPIPIFIKFGYYPPHVDPEYAGRASLHDKASLR 99

  Fly   134 IQ--AKDTAGPYPIPV----HRPEPVEN----HLEANNGIEGGMESLFGTPMYFGTENSTVVTTQ 188
            ::  ..:..|.|...|    .:.:...|    ||..|            .|..|.......:..:
Human   100 LEQVRSEDQGWYECKVLMLDQQYDTFHNGSWVHLTIN------------APPTFTETPPQYIEAK 152

  Fly   189 IGATAHVPCTVHHIGEGVVSWIRKKDYHLLTVGLTTYSSDERFSATHLKHSEDWTLQIKFVQLRD 253
            .|.:..:.||.....:.:|:|:::.         |...:..::..:      |.:|.:..|...|
Human   153 EGGSITMTCTAFGNPKPIVTWLKEG---------TLLGASGKYQVS------DGSLTVTSVSRED 202

  Fly   254 AGVYECQV---------STH-----------PPTSIFLHLS---VVEARAEITGPPIRYLTPGST 295
            .|.|.|:.         :||           ||.:|.:::|   ::..|||.....:.|.     
Human   203 RGAYTCRAYSIQGEAVHTTHLLVQGPPFIVSPPENITVNISQDALLTCRAEAYPGNLTYT----- 262

  Fly   296 LRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTIQRTRREHSGNFTCVAS 360
                              ||..:..:.:..|..:.|....|   ..|.|.|.:.|.||.:|||.|
Human   263 ------------------WYWQDENVYFQNDLKLRVRILID---GTLIIFRVKPEDSGKYTCVPS 306

  Fly   361 NT--------------QPASVLVHIFKGDNPAAMY-----HGHV 385
            |:              .||.||      :.|..:|     ||::
Human   307 NSLGRSPSASAYLTVQYPARVL------NMPPVIYVPVGIHGYI 344

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 19/118 (16%)
IG_like 182..262 CDD:214653 13/88 (15%)
IG_like 285..362 CDD:214653 16/76 (21%)
IGc2 292..361 CDD:197706 14/68 (21%)
IGSF9BNP_001264214.1 IG_like 30..115 CDD:214653 14/79 (18%)
Ig 41..115 CDD:143165 10/73 (14%)
I-set 139..225 CDD:254352 16/100 (16%)
IGc2 153..210 CDD:197706 13/71 (18%)
I-set 229..321 CDD:254352 24/117 (21%)
Ig 235..321 CDD:299845 23/111 (21%)
IG_like 331..414 CDD:214653 4/14 (29%)
Ig <353..414 CDD:299845
IG_like 426..505 CDD:214653
Ig 442..505 CDD:299845
FN3 510..601 CDD:238020
FN3 617..699 CDD:238020
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 758..817
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 911..1081
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.