DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment dpr13 and Iglon5

DIOPT Version :9

Sequence 1:NP_001033956.2 Gene:dpr13 / 3885598 FlyBaseID:FBgn0034286 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_001157990.1 Gene:Iglon5 / 210094 MGIID:2686277 Length:336 Species:Mus musculus


Alignment Length:347 Identity:80/347 - (23%)
Similarity:118/347 - (34%) Gaps:110/347 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 VPVPQPYAQ----SAASAGGSSITS-------------FDSTNVIDGQSQPTPTHLQEAVLQ--- 127
            :|.|.|.|:    :||:..|.::.|             .|:..|.:|.:......:.|.|.:   
Mouse     1 MPPPAPGARLRLLAAAALAGLAVISRGLLSQSLEFSSPADNYTVCEGDNATLSCFIDEHVTRVAW 65

  Fly   128 -THSHSRIQAKD--TAGP-YPIPVHRPEPVENHLEANNGIEGGMESLFGTPMYFGTENSTVVTTQ 188
             ..|:......|  |:.| ..:.::.||.. :.|....|:  |.|.|:  ...|.|.:.. .|||
Mouse    66 LNRSNILYAGNDRWTSDPRVRLLINTPEEF-SILITQVGL--GDEGLY--TCSFQTRHQP-YTTQ 124

  Fly   189 IGATAHVPCTVHHIG---------------------EGVVSWIRKKDYHLLTVGLTTYSSDERFS 232
            :....|||..:.:|.                     |..|:|.:.:|      |.|         
Mouse   125 VYLIVHVPARIVNISSPVAVNEGGNVNLLCLAVGRPEPTVTWRQLRD------GFT--------- 174

  Fly   233 ATHLKHSEDWTLQIKFVQLRDAGVYECQVSTH------------------PPTSIFLHLSVVEAR 279
                  ||...|:|..:|...||.|||  .||                  |||.    ..|..||
Mouse   175 ------SEGEILEISDIQRGQAGEYEC--VTHNGVNSAPDSRRVLVTVNYPPTI----TDVTSAR 227

  Fly   280 AEITGPPIRYLTPGSTLRLQCRVVQNTEASEYIFWYHDNRMINYDIDRGINVSTEPDFQSSELTI 344
            ..:          |....|:|..:....|.  ..||.|:|:::.....|:.|.||.  ..|.|..
Mouse   228 TAL----------GRAALLRCEAMAVPPAD--FQWYKDDRLLSSGSAEGLKVQTER--TRSMLLF 278

  Fly   345 QRTRREHSGNFTCVASNTQPAS 366
            ......|.||:||.|:|...||
Mouse   279 ANVSARHYGNYTCRAANRLGAS 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
dpr13NP_001033956.2 V-set 180..276 CDD:284989 28/134 (21%)
IG_like 182..262 CDD:214653 23/100 (23%)
IG_like 285..362 CDD:214653 20/76 (26%)
IGc2 292..361 CDD:197706 20/68 (29%)
Iglon5NP_001157990.1 Ig 41..129 CDD:416386 20/93 (22%)
Ig strand A' 41..46 CDD:409353 1/4 (25%)
Ig strand B 48..56 CDD:409353 0/7 (0%)
CDR1 56..60 CDD:409353 1/3 (33%)
FR2 61..68 CDD:409353 0/6 (0%)
Ig strand C 61..67 CDD:409353 0/5 (0%)
CDR2 69..79 CDD:409353 2/9 (22%)
Ig strand C' 71..74 CDD:409353 0/2 (0%)
Ig strand C' 76..79 CDD:409353 1/2 (50%)
FR3 80..115 CDD:409353 9/39 (23%)
Ig strand D 84..91 CDD:409353 0/6 (0%)
Ig strand E 94..100 CDD:409353 1/6 (17%)
Ig strand F 107..115 CDD:409353 2/9 (22%)
CDR3 116..120 CDD:409353 1/3 (33%)
Ig strand G 120..129 CDD:409353 3/9 (33%)
FR4 122..129 CDD:409353 3/6 (50%)
Ig strand A 132..137 CDD:409353 1/4 (25%)
Ig_3 134..199 CDD:404760 18/87 (21%)
Ig strand A' 140..145 CDD:409353 0/4 (0%)
Ig strand B 148..157 CDD:409353 0/8 (0%)
Ig strand C 163..167 CDD:409353 1/3 (33%)
Ig strand D 174..177 CDD:409353 2/17 (12%)
Ig strand E 178..183 CDD:409353 1/4 (25%)
Ig strand F 191..199 CDD:409353 5/9 (56%)
Ig_3 217..295 CDD:404760 26/95 (27%)
putative Ig strand A 218..224 CDD:409353 2/9 (22%)
Ig strand B 234..238 CDD:409353 1/3 (33%)
Ig strand C 247..251 CDD:409353 0/5 (0%)
Ig strand E 274..278 CDD:409353 2/3 (67%)
Ig strand F 288..293 CDD:409353 3/4 (75%)
Ig strand G 301..304 CDD:409353 80/347 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3510
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.